LOCUS       XM_009079984             789 bp    mRNA    linear   VRT 05-SEP-2014
DEFINITION  PREDICTED: Acanthisitta chloris ST6
            (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,
            3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5
            (ST6GALNAC5), mRNA.
ACCESSION   XM_009079984
VERSION     XM_009079984.1
DBLINK      BioProject: PRJNA253841
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Acanthisitta chloris (rifleman)
  ORGANISM  Acanthisitta chloris
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Passeriformes; Acanthisittidae;
            Acanthisitta.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_008686090.1) annotated using gene prediction method: Gnomon,
            supported by mRNA and EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Acanthisitta chloris Annotation
                                           Release 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 3% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..789
                     /organism="Acanthisitta chloris"
                     /mol_type="mRNA"
                     /isolate="BGI_N310"
                     /db_xref="taxon:57068"
                     /chromosome="Unknown"
                     /sex="female"
                     /country="New Zealand"
     gene            1..789
                     /gene="ST6GALNAC5"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 mRNA, 1 EST, 11 Proteins"
                     /db_xref="GeneID:103807262"
     CDS             1..789
                     /gene="ST6GALNAC5"
                     /codon_start=1
                     /product="alpha-N-acetylgalactosaminide
                     alpha-2,6-sialyltransferase 5"
                     /protein_id="XP_009078232.1"
                     /db_xref="GeneID:103807262"
                     /translation="

MSAANFEVCMSLQPLKMHCKSCALVTSSGHLLGSKQGDRIDETECVIRMNDAPTRGYGKDVGNKTSLRVIAHSSIQRILRNRNELLNMSHGAVFIFWGPSSYMRRDGKGLVYNNLQLMNQILPQLKVYMISRHKMLQFDDLFKRETGKDRKISNTWLSTGWFTMTIALELCDRINVYGMVPPDFCRDPNHLSVPYHYYEPLGPDECTMYISHERGRKGSHHRFITEKRVFENWARTFNIHFFQPDWKPEPLTVHRPENKPVV"

     misc_feature    31..597
                     /gene="ST6GALNAC5"
                     /note="Glycosyltransferase family 29 (sialyltransferase);
                     Region: Glyco_transf_29; pfam00777"
                     /db_xref="CDD:425864"
ORIGIN      

atgtctgcagctaattttgaagtatgtatgtctttgcagccgttaaaaatgcactgcaagagttgtgcattggtcaccagctctggacaccttctgggaagtaaacaaggggacagaatcgacgagacggagtgtgtaatacgaatgaatgatgcacctactcgaggttatggaaaagatgttggaaacaaaacgagccttcgagtcattgcacactccagtattcagaggattttgcgaaatcgcaacgaactcttaaacatgagccacggtgccgtgttcatcttctggggcccgagcagctacatgcggagagatgggaagggcttggtgtacaacaacctgcagctgatgaaccagatactgcctcaactaaaagtatatatgatttctcgccataagatgcttcaatttgatgacctttttaaacgggaaactgggaaggacaggaagatatccaacacttggctcagcacgggctggttcacaatgactatcgcattagagctctgtgacaggataaatgtttatggcatggtgccaccggatttctgcagggatcctaatcatctctcagtaccttaccattattacgaacctctgggacctgacgaatgcacaatgtacatttcccacgagcggggacggaagggcagccaccaccgcttcatcacagagaaacgtgtctttgagaactgggcacggaccttcaacattcactttttccaaccagactggaaaccagaaccactcactgtacatcgccccgagaacaaaccggtggtctga

//