2024-05-19 11:49:32, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_008709058 936 bp mRNA linear MAM 09-APR-2021 DEFINITION PREDICTED: Ursus maritimus copper chaperone for superoxide dismutase (CCS), transcript variant X2, mRNA. ACCESSION XM_008709058 VERSION XM_008709058.2 DBLINK BioProject: PRJNA717889 KEYWORDS RefSeq. SOURCE Ursus maritimus (polar bear) ORGANISM Ursus maritimus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Ursidae; Ursus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024424786.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Apr 9, 2021 this sequence version replaced XM_008709058.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Ursus maritimus Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..936 /organism="Ursus maritimus" /mol_type="mRNA" /isolate="PB19" /db_xref="taxon:29073" /chromosome="Unknown" /tissue_type="whole blood" /dev_stage="adult" gene 1..936 /gene="CCS" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 27 samples with support for all annotated introns" /db_xref="GeneID:103679498" CDS 123..797 /gene="CCS" /codon_start=1 /product="copper chaperone for superoxide dismutase isoform X2" /protein_id="XP_008707280.1" /db_xref="GeneID:103679498" /translation="
MATDSGDRGTACTLEFTVQMTCQSCVDAVRTSLQGVAGVQSVEVQLENQMVLVQTTLPSEEVQALLEGTGRQAVLKGMGSGLLQNLGAAVAILEGPGPVQGVVRFLQLTPERCLIEGTIDGLEPGPHGLHVHQFGDLTGSCNSCGDHFNPDGASHGGPQDSDRHGMFQTFQSTETCPKLLCPHHPLSTVTNSWPVQLLASPVSSTPPAFLHRYFEADQDIISCN"
misc_feature 162..>602 /gene="CCS" /note="copper, zinc superoxide dismutase; Region: PLN02957" /db_xref="CDD:215516" ORIGIN
gcgcgcaccaggaggcggggcaaagtgtggcttccgaagctccgcctccccgcgacgcagttaggggtttgtgcttcaacgctggagcggttcgggtccgaaggctggtgactgggtccgggatggctacggactccggggaccgcgggaccgcctgcacgctggagttcacagtgcagatgacctgtcagagctgcgtggacgcggtgcgcacgtccctgcaaggagtggcaggtgtccagagtgtggaagtgcagttggagaaccagatggtcctggtgcagaccaccctgcccagcgaagaggtgcaggcccttctggaaggcacagggcgacaggcggtgctcaagggcatgggcagtggcctattgcagaatctgggggcagcagttgccattctggagggccctggtcctgtgcaaggggtggtgcgcttcctgcagctgacccctgaacgctgcctcatcgaggggaccattgatggcctggagcctgggcctcatggactccacgtccatcagtttggggacctcacagggagctgcaacagctgtggggaccactttaaccctgatggagcatctcacgggggccctcaggactccgaccggcatggaatgtttcagacattccaaagtacagaaacttgtcccaagctcctgtgtccccatcacccactttcaaccgtgaccaactcttggccagtccaactcttggccagtcctgtttcatctacacctccagcctttctccaccgatattttgaagcagatcaagacatcatttcatgtaactaagcaccgtggggacctggggaacgtccatgctgatgctgatggccgagccagctttaggatagaggatgagcagctgaaggtatggtggaaaagaaggtggggagctctcctaacaggtccactgtttgaggctcttatc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]