GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-19 11:49:32, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_008709058             936 bp    mRNA    linear   MAM 09-APR-2021
DEFINITION  PREDICTED: Ursus maritimus copper chaperone for superoxide
            dismutase (CCS), transcript variant X2, mRNA.
ACCESSION   XM_008709058
VERSION     XM_008709058.2
DBLINK      BioProject: PRJNA717889
KEYWORDS    RefSeq.
SOURCE      Ursus maritimus (polar bear)
  ORGANISM  Ursus maritimus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Ursidae;
            Ursus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024424786.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Apr 9, 2021 this sequence version replaced XM_008709058.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Ursus maritimus Annotation Release
                                           101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..936
                     /organism="Ursus maritimus"
                     /mol_type="mRNA"
                     /isolate="PB19"
                     /db_xref="taxon:29073"
                     /chromosome="Unknown"
                     /tissue_type="whole blood"
                     /dev_stage="adult"
     gene            1..936
                     /gene="CCS"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 27 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:103679498"
     CDS             123..797
                     /gene="CCS"
                     /codon_start=1
                     /product="copper chaperone for superoxide dismutase
                     isoform X2"
                     /protein_id="XP_008707280.1"
                     /db_xref="GeneID:103679498"
                     /translation="
MATDSGDRGTACTLEFTVQMTCQSCVDAVRTSLQGVAGVQSVEVQLENQMVLVQTTLPSEEVQALLEGTGRQAVLKGMGSGLLQNLGAAVAILEGPGPVQGVVRFLQLTPERCLIEGTIDGLEPGPHGLHVHQFGDLTGSCNSCGDHFNPDGASHGGPQDSDRHGMFQTFQSTETCPKLLCPHHPLSTVTNSWPVQLLASPVSSTPPAFLHRYFEADQDIISCN"
     misc_feature    162..>602
                     /gene="CCS"
                     /note="copper, zinc superoxide dismutase; Region:
                     PLN02957"
                     /db_xref="CDD:215516"
ORIGIN      
gcgcgcaccaggaggcggggcaaagtgtggcttccgaagctccgcctccccgcgacgcagttaggggtttgtgcttcaacgctggagcggttcgggtccgaaggctggtgactgggtccgggatggctacggactccggggaccgcgggaccgcctgcacgctggagttcacagtgcagatgacctgtcagagctgcgtggacgcggtgcgcacgtccctgcaaggagtggcaggtgtccagagtgtggaagtgcagttggagaaccagatggtcctggtgcagaccaccctgcccagcgaagaggtgcaggcccttctggaaggcacagggcgacaggcggtgctcaagggcatgggcagtggcctattgcagaatctgggggcagcagttgccattctggagggccctggtcctgtgcaaggggtggtgcgcttcctgcagctgacccctgaacgctgcctcatcgaggggaccattgatggcctggagcctgggcctcatggactccacgtccatcagtttggggacctcacagggagctgcaacagctgtggggaccactttaaccctgatggagcatctcacgggggccctcaggactccgaccggcatggaatgtttcagacattccaaagtacagaaacttgtcccaagctcctgtgtccccatcacccactttcaaccgtgaccaactcttggccagtccaactcttggccagtcctgtttcatctacacctccagcctttctccaccgatattttgaagcagatcaagacatcatttcatgtaactaagcaccgtggggacctggggaacgtccatgctgatgctgatggccgagccagctttaggatagaggatgagcagctgaaggtatggtggaaaagaaggtggggagctctcctaacaggtccactgtttgaggctcttatc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]