GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-20 05:34:48, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_008526274             720 bp    mRNA    linear   MAM 14-JUL-2014
DEFINITION  PREDICTED: Equus przewalskii leucine zipper protein 6 (LUZP6),
            mRNA.
ACCESSION   XM_008526274
VERSION     XM_008526274.1
DBLINK      BioProject: PRJNA253941
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Equus przewalskii (Przewalski's horse)
  ORGANISM  Equus przewalskii
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_007674063.1) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Equus przewalskii Annotation Release
                                           100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 15% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..720
                     /organism="Equus przewalskii"
                     /mol_type="mRNA"
                     /isolate="Burgud"
                     /db_xref="taxon:9798"
                     /chromosome="Unknown"
                     /sex="male"
                     /country="China: Xinjiang"
                     /collection_date="12-Feb-2012"
     gene            1..720
                     /gene="LUZP6"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 ESTs, 1 Protein, and 94%
                     coverage of the annotated genomic feature by RNAseq
                     alignments"
                     /db_xref="GeneID:103554958"
     CDS             1..210
                     /gene="LUZP6"
                     /codon_start=1
                     /product="leucine zipper protein 6"
                     /protein_id="XP_008524496.1"
                     /db_xref="GeneID:103554958"
                     /translation="
MQPITVGLKFCIQSVISYALYRVNTGGLPVYISVLTPFPLQLQTGICRLLVQIQHLRILKEFSYAELTF"
ORIGIN      
atgcagcctattacagtcggattaaaattttgtattcagtcagtcatttcgtatgcactatatcgagtaaacacaggtggtttacctgtttacattagtgttctaacacctttccccttgcagcttcagactggtatctgtagacttctagttcaaatacagcacctgcggatactcaaggagttctcctatgcggagctcaccttctaaacgcagtggggcaagaaggagaggtaggtgggtgcaacgtgtggaagctgcaaggaagtaggccctttattcattgatttctttcccccaaataatggattttaaatctatatgtacctgtttgatttttttttcctgaaacttcatctgagctgctgttttcttccatgcaatattgtatactcgattgtgtatagaagaagctggtgagagtgccctcctacataagcaattgcagtgtttttgcatgcaaaatttaaaaaatttaaattgtcctgattctattttgtaaatggagaaacaatcctatctttctaagcagtaatggaagaagactagtgctttgtgcattttgatatatttgagttcattttttccacaatgtaatacttttgacacaattgagtttctcatattatcctggttcatgtacatcagaatgctaaataatactgtgtttaagttttgtgttgcaagaacaaatggaataaacttgaattgtgctacagg
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]