2024-05-20 05:34:48, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_008526274 720 bp mRNA linear MAM 14-JUL-2014 DEFINITION PREDICTED: Equus przewalskii leucine zipper protein 6 (LUZP6), mRNA. ACCESSION XM_008526274 VERSION XM_008526274.1 DBLINK BioProject: PRJNA253941 KEYWORDS RefSeq; includes ab initio. SOURCE Equus przewalskii (Przewalski's horse) ORGANISM Equus przewalskii Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_007674063.1) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Equus przewalskii Annotation Release 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 6.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 15% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..720 /organism="Equus przewalskii" /mol_type="mRNA" /isolate="Burgud" /db_xref="taxon:9798" /chromosome="Unknown" /sex="male" /country="China: Xinjiang" /collection_date="12-Feb-2012" gene 1..720 /gene="LUZP6" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 ESTs, 1 Protein, and 94% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:103554958" CDS 1..210 /gene="LUZP6" /codon_start=1 /product="leucine zipper protein 6" /protein_id="XP_008524496.1" /db_xref="GeneID:103554958" /translation="
MQPITVGLKFCIQSVISYALYRVNTGGLPVYISVLTPFPLQLQTGICRLLVQIQHLRILKEFSYAELTF"
ORIGIN
atgcagcctattacagtcggattaaaattttgtattcagtcagtcatttcgtatgcactatatcgagtaaacacaggtggtttacctgtttacattagtgttctaacacctttccccttgcagcttcagactggtatctgtagacttctagttcaaatacagcacctgcggatactcaaggagttctcctatgcggagctcaccttctaaacgcagtggggcaagaaggagaggtaggtgggtgcaacgtgtggaagctgcaaggaagtaggccctttattcattgatttctttcccccaaataatggattttaaatctatatgtacctgtttgatttttttttcctgaaacttcatctgagctgctgttttcttccatgcaatattgtatactcgattgtgtatagaagaagctggtgagagtgccctcctacataagcaattgcagtgtttttgcatgcaaaatttaaaaaatttaaattgtcctgattctattttgtaaatggagaaacaatcctatctttctaagcagtaatggaagaagactagtgctttgtgcattttgatatatttgagttcattttttccacaatgtaatacttttgacacaattgagtttctcatattatcctggttcatgtacatcagaatgctaaataatactgtgtttaagttttgtgttgcaagaacaaatggaataaacttgaattgtgctacagg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]