LOCUS       XM_008512598             676 bp    mRNA    linear   MAM 14-JUL-2014
DEFINITION  PREDICTED: Equus przewalskii copper-transporting ATPase 2-like
            (LOC103546164), mRNA.
ACCESSION   XM_008512598
VERSION     XM_008512598.1
DBLINK      BioProject: PRJNA253941
KEYWORDS    RefSeq.
SOURCE      Equus przewalskii (Przewalski's horse)
  ORGANISM  Equus przewalskii
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_007723612.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Equus przewalskii Annotation Release
                                           100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..676
                     /organism="Equus przewalskii"
                     /mol_type="mRNA"
                     /isolate="Burgud"
                     /db_xref="taxon:9798"
                     /chromosome="Unknown"
                     /sex="male"
                     /country="China: Xinjiang"
                     /collection_date="12-Feb-2012"
     gene            1..676
                     /gene="LOC103546164"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 35 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:103546164"
     CDS             32..430
                     /gene="LOC103546164"
                     /codon_start=1
                     /product="copper-transporting ATPase 2-like"
                     /protein_id="XP_008510820.1"
                     /db_xref="GeneID:103546164"
                     /translation="

MVGDGVNDSPALAQADVGIAIGTGTDVAIEAADVVLIRNDLLDVVASIHLSKKTIWRIRLNLVLALIYNLVGIPVAAGRWLSPAVPPSTAAAGQKGWLLPARLPPHVVSSHIAGWLARSIAERVDFIVFSAL"

     misc_feature    <32..265
                     /gene="LOC103546164"
                     /note="Haloacid Dehalogenase-like Hydrolases; Region:
                     HAD_like; cl21460"
                     /db_xref="CDD:451251"
ORIGIN      

ggagctccagaacaaagggaagaaagttgccatggtgggagatggggttaacgactccccagccttggcccaggccgacgtgggcattgccatcgggacaggcacagatgtcgccatcgaggcggctgacgttgtcctcatcagaaatgatttgcttgatgtggtggctagcattcacctctccaagaagaccatctggagaatacgcctcaacctggtgctggcgctgatttataacctggtggggattcccgtcgcagcaggtaggtggctctcacctgctgtgccaccttcgactgcagctgccggccagaaaggctggttgctgccggccaggctcccgccacacgtagtgagtagccacattgctggctggctggccagaagcattgctgaaagagttgattttattgtgttctctgctttataagtctctaaaggtaaatgaggaaatgcagcacggacccaaactgtcattcactctgctcctctctgaaaagctggccaagatgcttgaccgtttatttatcgtggctgtattttctgaaccatttattaagacataaaacctgaaaaagaatccttattaacagttagggggcacctgctacacgatcagcacagggagtgatgtttctgaaccttatcttaaaaagtaatcctgcccggcttttac

//