2024-05-19 09:06:50, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_008082152 297 bp mRNA linear PLN 04-JAN-2024 DEFINITION Glarea lozoyensis ATCC 20868 uncharacterized protein (GLAREA_07464), partial mRNA. ACCESSION XM_008082152 VERSION XM_008082152.1 DBLINK BioProject: PRJNA246203 BioSample: SAMN02981444 KEYWORDS RefSeq. SOURCE Glarea lozoyensis ATCC 20868 ORGANISM Glarea lozoyensis ATCC 20868 Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Leotiomycetes; Helotiales; Helotiaceae; Glarea. REFERENCE 1 (bases 1 to 297) AUTHORS Chen,L., Yue,Q., Zhang,X., Xiang,M., Wang,C., Li,S., Che,Y., Ortiz-Lopez,F.J., Bills,G.F., Liu,X. and An,Z. TITLE Genomics-driven discovery of the pneumocandin biosynthetic gene cluster in the fungus Glarea lozoyensis JOURNAL BMC Genomics 14, 339 (2013) PUBMED 23688303 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 297) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (29-DEC-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 297) AUTHORS Li,C. TITLE Direct Submission JOURNAL Submitted (09-AUG-2012) Institute of Microbiology, Chinese Academy of Sciences, The State Key Laboratory of Mycology (SKLM), No. 3 1st Beichen West Road, Chaoyang District, Beijing 100101, China COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_007360990). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..297 /organism="Glarea lozoyensis ATCC 20868" /mol_type="mRNA" /strain="ATCC 20868" /isolation_source="pond water from Valle del Rio Lozoya" /culture_collection="ATCC:20868" /type_material="culture from holotype of Glarea lozoyensis" /db_xref="taxon:1116229" /chromosome="Unknown" /country="Spain" gene <1..>297 /locus_tag="GLAREA_07464" /db_xref="GeneID:19466517" CDS 1..297 /locus_tag="GLAREA_07464" /note="GLAREA_07464" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_008080343.1" /db_xref="GeneID:19466517" /translation="
MPRNFSFTLIYVLALLGVAMSTSFSNTTHHTSTTCLTCNTTVSTKTAPHSDKTGTATRTGATGTGQGVISTGAAATGGVGVWEGIGLGVVVLGGLLGV"
ORIGIN
atgccacgcaatttctctttcaccctcatctacgtattggcacttctcggcgttgcaatgagcacgagtttctcaaataccactcatcacacttccaccacctgcctcacttgcaacactacggtctcgaccaagacggctccgcactcggataaaacgggcacggctactagaacgggcgcgacgggcacggggcagggcgtgattagtacgggtgcggctgctactgggggggttggggtgtgggaggggattgggttgggggtggtggttttgggggggcttttgggggtgtga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]