GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-19 09:06:50, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_008082152             297 bp    mRNA    linear   PLN 04-JAN-2024
DEFINITION  Glarea lozoyensis ATCC 20868 uncharacterized protein
            (GLAREA_07464), partial mRNA.
ACCESSION   XM_008082152
VERSION     XM_008082152.1
DBLINK      BioProject: PRJNA246203
            BioSample: SAMN02981444
KEYWORDS    RefSeq.
SOURCE      Glarea lozoyensis ATCC 20868
  ORGANISM  Glarea lozoyensis ATCC 20868
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Leotiomycetes; Helotiales; Helotiaceae; Glarea.
REFERENCE   1  (bases 1 to 297)
  AUTHORS   Chen,L., Yue,Q., Zhang,X., Xiang,M., Wang,C., Li,S., Che,Y.,
            Ortiz-Lopez,F.J., Bills,G.F., Liu,X. and An,Z.
  TITLE     Genomics-driven discovery of the pneumocandin biosynthetic gene
            cluster in the fungus Glarea lozoyensis
  JOURNAL   BMC Genomics 14, 339 (2013)
   PUBMED   23688303
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 297)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (29-DEC-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 297)
  AUTHORS   Li,C.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-AUG-2012) Institute of Microbiology, Chinese Academy
            of Sciences, The State Key Laboratory of Mycology (SKLM), No. 3 1st
            Beichen West Road, Chaoyang District, Beijing 100101, China
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_007360990).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..297
                     /organism="Glarea lozoyensis ATCC 20868"
                     /mol_type="mRNA"
                     /strain="ATCC 20868"
                     /isolation_source="pond water from Valle del Rio Lozoya"
                     /culture_collection="ATCC:20868"
                     /type_material="culture from holotype of Glarea
                     lozoyensis"
                     /db_xref="taxon:1116229"
                     /chromosome="Unknown"
                     /country="Spain"
     gene            <1..>297
                     /locus_tag="GLAREA_07464"
                     /db_xref="GeneID:19466517"
     CDS             1..297
                     /locus_tag="GLAREA_07464"
                     /note="GLAREA_07464"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_008080343.1"
                     /db_xref="GeneID:19466517"
                     /translation="
MPRNFSFTLIYVLALLGVAMSTSFSNTTHHTSTTCLTCNTTVSTKTAPHSDKTGTATRTGATGTGQGVISTGAAATGGVGVWEGIGLGVVVLGGLLGV"
ORIGIN      
atgccacgcaatttctctttcaccctcatctacgtattggcacttctcggcgttgcaatgagcacgagtttctcaaataccactcatcacacttccaccacctgcctcacttgcaacactacggtctcgaccaagacggctccgcactcggataaaacgggcacggctactagaacgggcgcgacgggcacggggcagggcgtgattagtacgggtgcggctgctactgggggggttggggtgtgggaggggattgggttgggggtggtggttttgggggggcttttgggggtgtga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]