2024-05-19 15:13:49, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_007926732 321 bp mRNA linear PLN 05-FEB-2020 DEFINITION Pseudocercospora fijiensis CIRAD86 uncharacterized protein (MYCFIDRAFT_173316), partial mRNA. ACCESSION XM_007926732 VERSION XM_007926732.1 DBLINK BioProject: PRJNA245146 BioSample: SAMN02744058 KEYWORDS RefSeq. SOURCE Pseudocercospora fijiensis CIRAD86 (Mycosphaerella fijiensis CIRAD86) ORGANISM Pseudocercospora fijiensis CIRAD86 Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Dothideomycetes; Dothideomycetidae; Mycosphaerellales; Mycosphaerellaceae; Pseudocercospora. REFERENCE 1 (bases 1 to 321) AUTHORS Ohm,R.A., Feau,N., Henrissat,B., Schoch,C.L., Horwitz,B.A., Barry,K.W., Condon,B.J., Copeland,A.C., Dhillon,B., Glaser,F., Hesse,C.N., Kosti,I., LaButti,K., Lindquist,E.A., Lucas,S., Salamov,A.A., Bradshaw,R.E., Ciuffetti,L., Hamelin,R.C., Kema,G.H., Lawrence,C., Scott,J.A., Spatafora,J.W., Turgeon,B.G., de Wit,P.J., Zhong,S., Goodwin,S.B. and Grigoriev,I.V. TITLE Diverse lifestyles and strategies of plant pathogenesis encoded in the genomes of eighteen Dothideomycetes fungi JOURNAL PLoS Pathog. 8 (12), E1003037 (2012) PUBMED 23236275 REFERENCE 2 (bases 1 to 321) AUTHORS Isaza,R.A., Trujillo,C.D., Dhillon,B., Aerts,A., Carlier,J., Crane,C.F., de Jong,T., de Vries,I., Dietrich,R., Farmer,A.D., Fereira,C.F., Garcia,S., Guzman,M., Lindquist,E.A., Mehrabi,R., Quiros,O., Schmutz,J., Shapiro,H., Reynolds,E., Scalliet,G., Souza,M. Jr., Stergiopoulos,I., Van der Lee,T.A.J., de Wit,P., Zapater,M.-F., Zwiers,L.-H., Grigoriev,I.V., Goodwin,S.B. and Kema,G.H. CONSRTM DOE Joint Genome Institute TITLE The genome sequence of the banana black Sigatoka pathogen Mycosphaerella fijiensis reveals an extraordinary species specific expansion and is applied to analyze avirulence and fungicide resistance JOURNAL Unpublished REFERENCE 3 (bases 1 to 321) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (05-FEB-2020) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 4 (bases 1 to 321) AUTHORS Aerts,A.L., Lapidus,A., Lindquist,E., Lucas,S., Ohm,R.A., Salamov,A., Schijlen,E., Sun,H., Zhang,S., Guo,Y., Chettri,P., Owen,T.J., Kabir,M.S., Schwelm,A., Henrissat,B., Goodwin,S.B., Kema,G.H. and Grigoriev,I.V. CONSRTM DOE Joint Genome Institute TITLE Direct Submission JOURNAL Submitted (21-SEP-2012) DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA 94598-1698, USA COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_006921534). ##Metadata-START## Organism Display Name :: Mycosphaerella fijiensis CIRAD86 GOLD Stamp ID :: Gi13816 ##Metadata-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..321 /organism="Pseudocercospora fijiensis CIRAD86" /mol_type="mRNA" /strain="CIRAD86" /culture_collection="CBS:120258" /db_xref="taxon:383855" /chromosome="Unknown" gene <1..>321 /locus_tag="MYCFIDRAFT_173316" /db_xref="GeneID:19332968" CDS 1..321 /locus_tag="MYCFIDRAFT_173316" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_007924923.1" /db_xref="GeneID:19332968" /db_xref="JGIDB:Mycfi2_173316" /translation="
MFLVQTFHISRSRLPLHMDFAQILALNVFEGRNQPHPFSYAEEAGLRLRKLAWVGFSCDTTATNFATVKSCESSKQQCLGMIAGLGLEPKDETDPNDGMHCKSCTW"
ORIGIN
atgtttcttgtgcagacctttcatatttcgagatcacgattgccactgcacatggactttgcacagatcttagctttgaatgtcttcgaagggaggaatcagccacacccgttcagctatgccgaggaagctggattgcggttgcggaaactggcatgggtcggtttctcatgcgataccacagcaaccaattttgcgaccgtcaaatcatgcgaaagcagcaagcagcagtgtttgggcatgattgctggcctaggcttggagccaaaagacgaaacagatccaaacgacggcatgcactgcaaatcatgcacgtggtga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]