GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-19 15:13:49, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_007926732             321 bp    mRNA    linear   PLN 05-FEB-2020
DEFINITION  Pseudocercospora fijiensis CIRAD86 uncharacterized protein
            (MYCFIDRAFT_173316), partial mRNA.
ACCESSION   XM_007926732
VERSION     XM_007926732.1
DBLINK      BioProject: PRJNA245146
            BioSample: SAMN02744058
KEYWORDS    RefSeq.
SOURCE      Pseudocercospora fijiensis CIRAD86 (Mycosphaerella fijiensis
            CIRAD86)
  ORGANISM  Pseudocercospora fijiensis CIRAD86
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Dothideomycetes; Dothideomycetidae; Mycosphaerellales;
            Mycosphaerellaceae; Pseudocercospora.
REFERENCE   1  (bases 1 to 321)
  AUTHORS   Ohm,R.A., Feau,N., Henrissat,B., Schoch,C.L., Horwitz,B.A.,
            Barry,K.W., Condon,B.J., Copeland,A.C., Dhillon,B., Glaser,F.,
            Hesse,C.N., Kosti,I., LaButti,K., Lindquist,E.A., Lucas,S.,
            Salamov,A.A., Bradshaw,R.E., Ciuffetti,L., Hamelin,R.C., Kema,G.H.,
            Lawrence,C., Scott,J.A., Spatafora,J.W., Turgeon,B.G., de Wit,P.J.,
            Zhong,S., Goodwin,S.B. and Grigoriev,I.V.
  TITLE     Diverse lifestyles and strategies of plant pathogenesis encoded in
            the genomes of eighteen Dothideomycetes fungi
  JOURNAL   PLoS Pathog. 8 (12), E1003037 (2012)
   PUBMED   23236275
REFERENCE   2  (bases 1 to 321)
  AUTHORS   Isaza,R.A., Trujillo,C.D., Dhillon,B., Aerts,A., Carlier,J.,
            Crane,C.F., de Jong,T., de Vries,I., Dietrich,R., Farmer,A.D.,
            Fereira,C.F., Garcia,S., Guzman,M., Lindquist,E.A., Mehrabi,R.,
            Quiros,O., Schmutz,J., Shapiro,H., Reynolds,E., Scalliet,G.,
            Souza,M. Jr., Stergiopoulos,I., Van der Lee,T.A.J., de Wit,P.,
            Zapater,M.-F., Zwiers,L.-H., Grigoriev,I.V., Goodwin,S.B. and
            Kema,G.H.
  CONSRTM   DOE Joint Genome Institute
  TITLE     The genome sequence of the banana black Sigatoka pathogen
            Mycosphaerella fijiensis reveals an extraordinary species specific
            expansion and is applied to analyze avirulence and fungicide
            resistance
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 321)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-FEB-2020) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 321)
  AUTHORS   Aerts,A.L., Lapidus,A., Lindquist,E., Lucas,S., Ohm,R.A.,
            Salamov,A., Schijlen,E., Sun,H., Zhang,S., Guo,Y., Chettri,P.,
            Owen,T.J., Kabir,M.S., Schwelm,A., Henrissat,B., Goodwin,S.B.,
            Kema,G.H. and Grigoriev,I.V.
  CONSRTM   DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (21-SEP-2012) DOE Joint Genome Institute, 2800 Mitchell
            Drive, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_006921534).
            
            ##Metadata-START##
            Organism Display Name :: Mycosphaerella fijiensis CIRAD86
            GOLD Stamp ID         :: Gi13816
            ##Metadata-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..321
                     /organism="Pseudocercospora fijiensis CIRAD86"
                     /mol_type="mRNA"
                     /strain="CIRAD86"
                     /culture_collection="CBS:120258"
                     /db_xref="taxon:383855"
                     /chromosome="Unknown"
     gene            <1..>321
                     /locus_tag="MYCFIDRAFT_173316"
                     /db_xref="GeneID:19332968"
     CDS             1..321
                     /locus_tag="MYCFIDRAFT_173316"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_007924923.1"
                     /db_xref="GeneID:19332968"
                     /db_xref="JGIDB:Mycfi2_173316"
                     /translation="
MFLVQTFHISRSRLPLHMDFAQILALNVFEGRNQPHPFSYAEEAGLRLRKLAWVGFSCDTTATNFATVKSCESSKQQCLGMIAGLGLEPKDETDPNDGMHCKSCTW"
ORIGIN      
atgtttcttgtgcagacctttcatatttcgagatcacgattgccactgcacatggactttgcacagatcttagctttgaatgtcttcgaagggaggaatcagccacacccgttcagctatgccgaggaagctggattgcggttgcggaaactggcatgggtcggtttctcatgcgataccacagcaaccaattttgcgaccgtcaaatcatgcgaaagcagcaagcagcagtgtttgggcatgattgctggcctaggcttggagccaaaagacgaaacagatccaaacgacggcatgcactgcaaatcatgcacgtggtga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]