GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-19 10:06:43, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_007873128             258 bp    mRNA    linear   PLN 02-JAN-2024
DEFINITION  Gloeophyllum trabeum ATCC 11539 uncharacterized protein
            (GLOTRDRAFT_50897), partial mRNA.
ACCESSION   XM_007873128
VERSION     XM_007873128.1
DBLINK      BioProject: PRJNA245137
            BioSample: SAMN02743873
KEYWORDS    RefSeq.
SOURCE      Gloeophyllum trabeum ATCC 11539
  ORGANISM  Gloeophyllum trabeum ATCC 11539
            Eukaryota; Fungi; Dikarya; Basidiomycota; Agaricomycotina;
            Agaricomycetes; Gloeophyllales; Gloeophyllaceae; Gloeophyllum.
REFERENCE   1  (bases 1 to 258)
  AUTHORS   Floudas,D., Binder,M., Riley,R., Barry,K., Blanchette,R.A.,
            Henrissat,B., Martinez,A.T., Otillar,R., Spatafora,J.W.,
            Yadav,J.S., Aerts,A., Benoit,I., Boyd,A., Carlson,A., Copeland,A.,
            Coutinho,P.M., de Vries,R.P., Ferreira,P., Findley,K., Foster,B.,
            Gaskell,J., Glotzer,D., Gorecki,P., Heitman,J., Hesse,C., Hori,C.,
            Igarashi,K., Jurgens,J.A., Kallen,N., Kersten,P., Kohler,A.,
            Kues,U., Kumar,T.K., Kuo,A., LaButti,K., Larrondo,L.F.,
            Lindquist,E., Ling,A., Lombard,V., Lucas,S., Lundell,T., Martin,R.,
            McLaughlin,D.J., Morgenstern,I., Morin,E., Murat,C., Nagy,L.G.,
            Nolan,M., Ohm,R.A., Patyshakuliyeva,A., Rokas,A., Ruiz-Duenas,F.J.,
            Sabat,G., Salamov,A., Samejima,M., Schmutz,J., Slot,J.C., St
            John,F., Stenlid,J., Sun,H., Sun,S., Syed,K., Tsang,A.,
            Wiebenga,A., Young,D., Pisabarro,A., Eastwood,D.C., Martin,F.,
            Cullen,D., Grigoriev,I.V. and Hibbett,D.S.
  TITLE     The Paleozoic origin of enzymatic lignin decomposition
            reconstructed from 31 fungal genomes
  JOURNAL   Science 336 (6089), 1715-1719 (2012)
   PUBMED   22745431
REFERENCE   2  (bases 1 to 258)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (29-DEC-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 258)
  AUTHORS   Riley,R., Floudas,D., Binder,M., Barry,K., Blanchette,R.A.,
            Henrissat,B., Martinez,A.T., Otillar,R., Spatafora,J.W.,
            Yadav,J.S., Aerts,A., Benoit,I., Boyd,A., Carlson,A., Copeland,A.,
            Coutinho,P.M., de Vries,R.P., Ferreira,P., Findley,K., Foster,B.,
            Gaskell,J., Glotzer,D., Gorecki,P., Heitman,J., Hesse,C., Hori,C.,
            Igarashi,K., Jurgens,J.A., Kallen,N., Kersten,P., Kohler,A.,
            Kues,U., Kumar,T.K., Kuo,A., LaButti,K., Larrondo,L.F.,
            Lindquist,E., Ling,A., Lombard,V., Lucas,S., Lundell,T., Martin,R.,
            McLaughlin,D.J., Morgenstern,I., Morin,E., Murat,C., Nagy,L.G.,
            Nolan,M., Ohm,R.A., Patyshakuliyeva,A., Rokas,A., Ruiz-Duenas,F.J.,
            Sabat,G., Salamov,A., Samejima,M., Schmutz,J., Slot,J.C., St
            John,F., Stenlid,J., Sun,H., Sun,S., Syed,K., Tsang,A.,
            Wiebenga,A., Young,D., Pisabarro,A., Eastwood,D.C., Martin,F.,
            Cullen,D., Hibbett,D.S. and Grigoriev,I.V.
  CONSRTM   US DOE Joint Genome Institute (JGI-PGF)
  TITLE     Direct Submission
  JOURNAL   Submitted (26-JUN-2012) US DOE Joint Genome Institute, 2800
            Mitchell Drive, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_006920437).
            
            ##Metadata-START##
            Organism Display Name :: Gloeophyllum trabeum ATCC 11539
            GOLD Stamp ID         :: Gi04922
            ##Metadata-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..258
                     /organism="Gloeophyllum trabeum ATCC 11539"
                     /mol_type="mRNA"
                     /strain="ATCC 11539"
                     /culture_collection="ATCC:11539"
                     /db_xref="taxon:670483"
                     /chromosome="Unknown"
     gene            <1..>258
                     /locus_tag="GLOTRDRAFT_50897"
                     /db_xref="GeneID:19306768"
     CDS             <1..258
                     /locus_tag="GLOTRDRAFT_50897"
                     /note="predicted protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_007871319.1"
                     /db_xref="GeneID:19306768"
                     /db_xref="JGIDB:Glotr1_1_50897"
                     /translation="
NLNLSKSFRFNIKGHKKYFLTGMVYHGEYHFNCRFIDKTGTIWYNDGITTGKQCVIEGTLSNTDMTDLTKCKGKDISLVIYAQCY"
ORIGIN      
aatctaaatctcagcaaaagtttccgattcaatatcaaaggacacaagaaatactttttaacaggaatggtctaccatggcgaataccatttcaactgtcgattcattgacaaaactgggacaatatggtacaatgatggtataaccacaggcaaacagtgtgtaattgaaggaaccttatcaaatacagatatgactgacttaaccaaatgtaaagggaaagacatttcattagtaatatatgcacagtgctattaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]