LOCUS       XM_006602497             282 bp    mRNA    linear   PLN 19-APR-2021
DEFINITION  PREDICTED: Glycine max plasma membrane ATPase 2-like
            (LOC102660489), mRNA.
ACCESSION   XM_006602497
VERSION     XM_006602497.2
DBLINK      BioProject: PRJNA48389
KEYWORDS    RefSeq.
SOURCE      Glycine max (soybean)
  ORGANISM  Glycine max
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50
            kb inversion clade; NPAAA clade; indigoferoid/millettioid clade;
            Phaseoleae; Glycine; Glycine subgen. Soja.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_038254.2) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Nov 25, 2015 this sequence version replaced XM_006602497.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Glycine max Annotation Release 104
            Annotation Version          :: 104
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..282
                     /organism="Glycine max"
                     /mol_type="mRNA"
                     /cultivar="Williams 82"
                     /db_xref="taxon:3847"
                     /chromosome="18"
                     /tissue_type="callus"
     gene            1..282
                     /gene="LOC102660489"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 89 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:102660489"
     CDS             49..282
                     /gene="LOC102660489"
                     /codon_start=1
                     /product="plasma membrane ATPase 2-like"
                     /protein_id="XP_006602560.1"
                     /db_xref="GeneID:102660489"
                     /translation="

MTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFAKGVDADTVVLMAAQASRLENQDAIDTAIVGMLADPKEVSH"

     misc_feature    <49..>270
                     /gene="LOC102660489"
                     /note="plasma-membrane proton-efflux P-type ATPase;
                     Region: ATPase-IIIA_H; TIGR01647"
                     /db_xref="CDD:273731"
ORIGIN      

ttaatggttaattagtaatgatttttgtagggggctatcacaaagagaatgacagctattgaagagatggcaggcatggatgtgctttgcagtgataagactgggaccctaacactaaataagcttactgttgacaaaaatcttatagaggtttttgcaaaaggagtggatgcggatactgttgttttgatggcagctcaagcttcaagacttgagaatcaagatgcaatagacactgccatagttggaatgttggctgatcccaaagaggttagtcattga

//