2024-05-18 17:22:33, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_006401912 267 bp mRNA linear PLN 26-FEB-2018 DEFINITION PREDICTED: Eutrema salsugineum root meristem growth factor 5 (LOC18016732), mRNA. ACCESSION XM_006401912 VERSION XM_006401912.1 DBLINK BioProject: PRJNA231865 KEYWORDS RefSeq. SOURCE Eutrema salsugineum ORGANISM Eutrema salsugineum Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_006256829.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Eutrema salsugineum Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..267 /organism="Eutrema salsugineum" /mol_type="mRNA" /db_xref="taxon:72664" /chromosome="Unknown" gene 1..267 /gene="LOC18016732" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:18016732" CDS 1..267 /gene="LOC18016732" /codon_start=1 /product="root meristem growth factor 5" /protein_id="XP_006401975.1" /db_xref="GeneID:18016732" /translation="
MSSAHAALILLLFLLLHLSDSRHLNNVHIKDSRFSLDKDQNVISSGLTSKEPVRVSRFVPGAVKNRHHRPPLFFADYPKPSTRPPRHN"
ORIGIN
atgagctcagcccatgctgctttgattcttctcttgtttctgctcttgcatctttcggattctcgtcacctcaacaatgttcacatcaaagattctcggttttcgcttgacaaggatcaaaatgttatctcctccggtttgacatctaaagaaccggttagagtttctcggtttgttccgggtgcagtgaagaaccgccaccatcggccaccactgttctttgcagattatccgaagccatccactcggccaccacgtcataactga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]