LOCUS       XM_006281836             383 bp    mRNA    linear   PLN 02-FEB-2018
DEFINITION  PREDICTED: Capsella rubella root meristem growth factor 1
            (LOC17877325), mRNA.
ACCESSION   XM_006281836
VERSION     XM_006281836.2
DBLINK      BioProject: PRJNA230563
KEYWORDS    RefSeq.
SOURCE      Capsella rubella
  ORGANISM  Capsella rubella
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Capsella.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_006238916.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Feb 2, 2018 this sequence version replaced XM_006281836.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Capsella rubella Annotation Release
                                           100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..383
                     /organism="Capsella rubella"
                     /mol_type="mRNA"
                     /cultivar="Monte Gargano"
                     /bio_material="ABRC:CS22697"
                     /db_xref="taxon:81985"
                     /chromosome="Unknown"
     gene            1..383
                     /gene="LOC17877325"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 Proteins, and 72% coverage of
                     the annotated genomic feature by RNAseq alignments"
                     /db_xref="GeneID:17877325"
     CDS             1..354
                     /gene="LOC17877325"
                     /codon_start=1
                     /product="root meristem growth factor 1"
                     /protein_id="XP_006281898.1"
                     /db_xref="GeneID:17877325"
                     /translation="

MVSIRVFCYLLIFFVLQVQAKVSNANFNRRAQKSENSESLRASTSSTQIANKLAEDVIENRKTLKHVNVKVEANEKNGFVIESKETVRKRKSKKRLTKTASLTADYSNPGHHPPRHN"

ORIGIN      

atggtgtccataagggttttttgctatctcttaatatttttcgttttacaagtacaagctaaagtctccaatgcaaactttaatcgccgagctcaaaaatcggaaaatagtgaaagtcttagagcaagcactagtagtactcaaattgccaacaagcttgctgaagatgtaattgaaaaccgaaagacgttgaagcatgtaaacgtgaaggtagaggcaaatgagaagaatggtttcgtgatagagagtaaagaaacggtgaggaaaagaaaaagcaagaagagactcaccaaaactgcgagtttgacggccgattatagcaaccctggtcatcatcctcctaggcacaactaaaaggactatttatatacattttaattaca

//