GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-18 17:14:58, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_006281338            1092 bp    mRNA    linear   PLN 02-FEB-2018
DEFINITION  PREDICTED: Capsella rubella root meristem growth factor 5
            (LOC17874702), mRNA.
ACCESSION   XM_006281338
VERSION     XM_006281338.2
DBLINK      BioProject: PRJNA230563
KEYWORDS    RefSeq.
SOURCE      Capsella rubella
  ORGANISM  Capsella rubella
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Capsella.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_006238916.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Feb 2, 2018 this sequence version replaced XM_006281338.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Capsella rubella Annotation Release
                                           100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1092
                     /organism="Capsella rubella"
                     /mol_type="mRNA"
                     /cultivar="Monte Gargano"
                     /bio_material="ABRC:CS22697"
                     /db_xref="taxon:81985"
                     /chromosome="Unknown"
     gene            1..1092
                     /gene="LOC17874702"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 11 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:17874702"
     CDS             670..915
                     /gene="LOC17874702"
                     /codon_start=1
                     /product="root meristem growth factor 5"
                     /protein_id="XP_006281400.1"
                     /db_xref="GeneID:17874702"
                     /translation="
MSSIHAASILLLFLLLHLSDSRHLDNVHITAKDQNVVSGLTPKEPVKVSRFVPRAVKHRHHRPPLFFADYPKPSTRPPRHN"
ORIGIN      
cagggaacattcttggtccagatgttgggttcttggttcttgaagctcttttactttgaactaacatgtgttatttgttttagaaacaggcaggatttgggcaattcaagaggactttttgaagacaagatgtctcggagattgcgtcaaagctcaaaaagtggtgttaacagtcatcgtcaacctccaaaccattctcgaggcagacaaaagcattaaggtaaattataataatgccttcaaaaagtgctttaagtttttcgcatattatataataatgatacaattcggaactagcttgcattttcttaatagaatatttaccgtggtggtcggtaagttttggggattggtctcaaataagatgttgtggagacaagaagtagtaaatcgctcgtttttcaccgaggtttatatgtctttttccttttgttgtttcttttttgactcatcttcggcttctcctatgagcttttccagcacattcatctggattgataagaaaaaacacttatttattcctgttttttgtgtgttctttttcttactttcaaatacttatgtgtgaactggctcttattatatagtgtctactacctagtaagtgcttttacgttctataacccttattgtcgttaacccttgagaactatttctgttgtgtgaccaatgagttcaattcatgctgcttcaatccttcttttgtttctgctcttgcatctttccgattctcgtcacctcgacaatgttcacatcactgccaaggatcaaaatgttgtctctggtttgacacctaaagaaccggtaaaggtttctaggtttgtgccgcgtgcagtgaagcaccgccatcatcggccgccactcttcttcgcagattatccgaagccgtccacgcggcctccgcgtcataactgaaacctctctctctcttgtagtttttttcatctttaggagtgtttttgtatgtgagagagtaaataggtcctttaacaattttcttaatacgtttccaagatgttggaactcttttttgaagtataggttcatgtttccctgacaaattctatctattttgagtaagttttcccaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]