GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-20 02:10:30, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_006041172             718 bp    mRNA    linear   MAM 17-NOV-2021
DEFINITION  PREDICTED: Bubalus bubalis leucine zipper protein 6 (LUZP6), mRNA.
ACCESSION   XM_006041172
VERSION     XM_006041172.2
DBLINK      BioProject: PRJNA779724
KEYWORDS    RefSeq; corrected model; includes ab initio.
SOURCE      Bubalus bubalis (water buffalo)
  ORGANISM  Bubalus bubalis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Ruminantia;
            Pecora; Bovidae; Bovinae; Bubalus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_059164.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Nov 3, 2021 this sequence version replaced XM_006041172.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Bubalus bubalis Annotation Release
                                           103
            Annotation Version          :: 103
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 9.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio   :: 16% of CDS bases
            frameshifts :: corrected 1 indel
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-33                VDCB01000005.1     99196172-99196204   c
            34-165              VDCB01000005.1     99195472-99195603   c
            166-718             VDCB01000005.1     99194918-99195470   c
FEATURES             Location/Qualifiers
     source          1..718
                     /organism="Bubalus bubalis"
                     /mol_type="mRNA"
                     /isolate="160015118507"
                     /db_xref="taxon:89462"
                     /chromosome="8"
                     /sex="female"
                     /tissue_type="blood"
                     /dev_stage="Adult Heifer"
                     /country="India: Hissar, Haryana"
                     /breed="Murrah"
     gene            1..718
                     /gene="LUZP6"
                     /note="The sequence of the model RefSeq transcript was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: deleted 1 base in 1 codon;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 1 Protein, and 93% coverage of the
                     annotated genomic feature by RNAseq alignments"
                     /db_xref="GeneID:102398285"
     CDS             1..240
                     /gene="LUZP6"
                     /note="The sequence of the model RefSeq protein was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: deleted 1 base in 1 codon"
                     /codon_start=1
                     /product="LOW QUALITY PROTEIN: leucine zipper protein 6"
                     /protein_id="XP_006041234.1"
                     /db_xref="GeneID:102398285"
                     /translation="
MEGTLSACTVSFCIKSVFSYALFQVKTGGLPVYISILTGSPWQLQTGVCRLRVQLRHRNRPSSSLHSSPSKPSGWGLKK"
     polyA_site      718
                     /gene="LUZP6"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
atggagggcactctgtcagcgtgtactgtcagcttttgtattaagtcagtcttttcatatgcactatttcaagtgaaaacaggtggtttgcctgtctacattagtatcctaacaggttccccctggcagcttcagactggcgtctgtagacttagagttcagctacggcaccggaatcgacccagtagttctctgcacagttcaccttctaaacccagtgggtggggcctgaagaagtaggtggatgccatgggtggaagctgccagcaagcagacccttcattcattgatttccttcccccaaataatggatttcaaatctgtatgtacctatttgatttttttcccctaaaacttcaactaagctgctgttttcttccatgcaatattgtatactcaattgtgtatagaagaagctggtgcgagtgccctcctacataagcaattgcagtgtttgcatgcaaaattttaaaaaatttaaattgtcctgattctattttgtaaatggagaaacaatcatatctttctaaggagtaatggaggaagactagtgctttgtgcattttgatatatttgagttcattttttccacagtgtaatacatttgacacagttggggttctcattatcctagttcatgtacatcagaatgctaaataatactgtgtttaagttttgtgttgcaagaacaaatggaataaacttgaattgtgctaca
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]