LOCUS       XM_005853002            1040 bp    mRNA    linear   MAM 04-NOV-2015
DEFINITION  PREDICTED: Myotis brandtii cathepsin O-like (LOC102254807), mRNA.
ACCESSION   XM_005853002
VERSION     XM_005853002.2
DBLINK      BioProject: PRJNA218631
KEYWORDS    RefSeq.
SOURCE      Myotis brandtii (Brandt's bat)
  ORGANISM  Myotis brandtii
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Chiroptera; Microchiroptera;
            Vespertilionidae; Myotis.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_005325292.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Nov 4, 2015 this sequence version replaced XM_005853002.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Myotis brandtii Annotation Release
                                           101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.4
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1040
                     /organism="Myotis brandtii"
                     /mol_type="mRNA"
                     /db_xref="taxon:109478"
                     /chromosome="Unknown"
                     /sex="male"
                     /country="Russia: Perm poKrai"
                     /lat_lon="58.8348 N 57.6119 E"
                     /collection_date="Dec-2011"
                     /note="collected at hibernation roost"
     gene            1..1040
                     /gene="LOC102254807"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 27 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:102254807"
     CDS             382..633
                     /gene="LOC102254807"
                     /codon_start=1
                     /product="cathepsin O-like"
                     /protein_id="XP_005853064.1"
                     /db_xref="GeneID:102254807"
                     /translation="

MAKALLTFGPLVGIVDAVSWQDYLGGIIQHHCSSGEANHAIIITGFDKTGTTPYWIVRNSWGSSWGVDGYAHVKMGSNICGES"

     misc_feature    <382..624
                     /gene="LOC102254807"
                     /note="C1 Peptidase family (MEROPS database nomenclature),
                     also referred to as the papain family; composed of two
                     subfamilies of cysteine peptidases (CPs), C1A (papain) and
                     C1B (bleomycin hydrolase). Papain-like enzymes are mostly
                     endopeptidases with some...; Region: Peptidase_C1;
                     cl23744"
                     /db_xref="CDD:451520"
ORIGIN      

aatgtgtgtgttacttctgggaaatcttctcaacaggaatgcaacacctctcctttctactccctgctgaaaggaatatatgttaaatggctggagctcctgaagccatcttggaccattaattgaacttgggaatggacacctcacatggcagaataatagcataagaggagcctgggttcttgatatctattgcagtcctggactaccagtctcctagacttcttgtagcctccattgtttaagtcttctgtaattgcaaccaaacctatgtgtatccatacagagattaaagagatcgttttaatacaatattcttaccttaaaaactaaactccttaaccaaatattttctcttttggtagtgaccaagaagacgaaatggcaaaagcactccttacctttggtcctttggtagggatagtagatgcagtgagctggcaagattacctgggagggataatacagcatcactgctctagtggagaagcaaatcatgctattatcataactgggtttgataaaacaggaactactccatattggattgtacggaactcatggggaagttcctggggagtggatggctatgcccatgtgaaaatgggaagtaatatttgcggtgagtcatgaatttgtgtttaaagctccagcctaagtgtcaaggaagatattctgaatatattaaaattataaacctgtccaatccatagtatgtttccaacatactcacatcacttaataattgataaaaatagaatagttttttaaagaagagacactattgcacatattcatgctttaaaaaggaagaaagactgtagtaaaaacaaatataataagcaaaacataataagataaactaataatttaccaaagttaactacttcaaaatccagaggcttttggatttaaaaatactcaacttaggaggctgaagttctccaaaaagtcccctcgttccaattttacttgttataactgtatgagtttttcttaatttgtgcattaataatacttgcacaaagattgtcaagcat

//