2024-05-16 15:30:03, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_004980628 342 bp mRNA linear PLN 13-OCT-2017 DEFINITION PREDICTED: Setaria italica protein FLORAL ORGAN NUMBER2-like (LOC101764297), mRNA. ACCESSION XM_004980628 VERSION XM_004980628.1 DBLINK BioProject: PRJNA207554 KEYWORDS RefSeq; includes ab initio. SOURCE Setaria italica (foxtail millet) ORGANISM Setaria italica Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_028457.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Setaria italica Annotation Release 103 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 7.4 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..342 /organism="Setaria italica" /mol_type="mRNA" /strain="Yugu1" /db_xref="taxon:4555" /chromosome="VIII" gene 1..342 /gene="LOC101764297" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:101764297" CDS 1..342 /gene="LOC101764297" /codon_start=1 /product="protein FLORAL ORGAN NUMBER2-like" /protein_id="XP_004980685.1" /db_xref="GeneID:101764297" /translation="
MARFFLCLAAAACCCLLALLVPPVHGRPGTGLASGGSFGGRDHPLSGPHVVTAEELRGTTVKAKPSWSSSSWTAAAAVGGRVRPELRSVPGGPDPLHHHGSPWRPELEQPITP"
ORIGIN
atggcccggttcttcctgtgcttggcggcggccgcgtgctgctgcctccttgcgttgctggttcctccagtgcatgggcgccctggcactggtctcgccagcggtggatcatttggcggtagggatcatccgctctccggaccacatgtcgtgacggcggaggagctgcgcggcacgacggtgaaggccaagccgtcgtggtcatcgtcgtcttggactgcagcggcggcggtggggggcagggtgaggccggagctgcggtcggtgccggggggcccggacccgctgcaccaccacggcagcccgtggcggccggagctggagcagccgatcacaccttga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]