GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-18 15:55:15, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_004336997             283 bp    mRNA    linear   INV 07-OCT-2021
DEFINITION  Acanthamoeba castellanii str. Neff uncharacterized protein
            (ACA1_213090), partial mRNA.
ACCESSION   XM_004336997
VERSION     XM_004336997.1
DBLINK      BioProject: PRJNA193615
            BioSample: SAMN02953809
KEYWORDS    RefSeq.
SOURCE      Acanthamoeba castellanii str. Neff
  ORGANISM  Acanthamoeba castellanii str. Neff
            Eukaryota; Amoebozoa; Discosea; Longamoebia; Centramoebida;
            Acanthamoebidae; Acanthamoeba.
REFERENCE   1  (bases 1 to 283)
  AUTHORS   Clarke,M., Lohan,A.J., Liu,B., Lagkouvardos,I., Roy,S., Zafar,N.,
            Bertelli,C., Schilde,C., Kianianmomeni,A., Burglin,T.R., Frech,C.,
            Turcotte,B., Kopec,K.O., Synnott,J.M., Choo,C., Paponov,I.,
            Finkler,A., Soon Heng Tan,C., Hutchins,A.P., Weinmeier,T.,
            Rattei,T., Chu,J.S., Gimenez,G., Irimia,M., Rigden,D.J.,
            Fitzpatrick,D.A., Lorenzo-Morales,J., Bateman,A., Chiu,C.H.,
            Tang,P., Hegemann,P., Fromm,H., Raoult,D., Greub,G.,
            Miranda-Saavedra,D., Chen,N., Nash,P., Ginger,M.L., Horn,M.,
            Schaap,P., Caler,L. and Loftus,B.
  TITLE     Genome of Acanthamoeba castellanii highlights extensive lateral
            gene transfer and early evolution of tyrosine kinase signaling
  JOURNAL   Genome Biol. 14 (2), R11 (2013)
   PUBMED   23375108
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 283)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (06-OCT-2021) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 283)
  AUTHORS   Clarke,M., Zafar,N., Loftus,B. and Caler,E.
  TITLE     Direct Submission
  JOURNAL   Submitted (24-OCT-2012) J. Craig Venter Institute, 9704 Medical
            Center Drive, Rockville, MD 20850, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_004457380).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..283
                     /organism="Acanthamoeba castellanii str. Neff"
                     /mol_type="mRNA"
                     /strain="Neff"
                     /isolation_source="pond"
                     /culture_collection="ATCC:30010"
                     /db_xref="taxon:1257118"
                     /chromosome="Unknown"
                     /country="USA"
                     /collection_date="1960"
     gene            <1..>283
                     /locus_tag="ACA1_213090"
                     /db_xref="GeneID:14915852"
     CDS             1..>283
                     /locus_tag="ACA1_213090"
                     /note="encoded by transcript ACA1_213090A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_004337045.1"
                     /db_xref="GeneID:14915852"
                     /translation="
MALAIAVAALNRERAGAGVGEAEERRARALAAAMVAWAEGQAAQLMTTPATDDGREVGRPPRHNFCFKCGAALHSAATFCADCGVKLPREGDTE"
ORIGIN      
atggcgctggccatcgccgtggccgcgctcaacagagaacgcgccggcgccggcgttggtgaggcggaggagcggcgggcgcgggcgctggcggcggcgatggtggcgtgggccgagggccaggcggcgcagctgatgacgacgccggcgacggacgacgggcgcgaggtggggcggccgccgcggcacaacttctgcttcaagtgcggcgcggccctgcactcggccgccaccttctgcgccgactgcggcgtcaagctcccgcgcgagggcgacaccgagg
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]