2024-05-18 15:55:15, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_004336997 283 bp mRNA linear INV 07-OCT-2021 DEFINITION Acanthamoeba castellanii str. Neff uncharacterized protein (ACA1_213090), partial mRNA. ACCESSION XM_004336997 VERSION XM_004336997.1 DBLINK BioProject: PRJNA193615 BioSample: SAMN02953809 KEYWORDS RefSeq. SOURCE Acanthamoeba castellanii str. Neff ORGANISM Acanthamoeba castellanii str. Neff Eukaryota; Amoebozoa; Discosea; Longamoebia; Centramoebida; Acanthamoebidae; Acanthamoeba. REFERENCE 1 (bases 1 to 283) AUTHORS Clarke,M., Lohan,A.J., Liu,B., Lagkouvardos,I., Roy,S., Zafar,N., Bertelli,C., Schilde,C., Kianianmomeni,A., Burglin,T.R., Frech,C., Turcotte,B., Kopec,K.O., Synnott,J.M., Choo,C., Paponov,I., Finkler,A., Soon Heng Tan,C., Hutchins,A.P., Weinmeier,T., Rattei,T., Chu,J.S., Gimenez,G., Irimia,M., Rigden,D.J., Fitzpatrick,D.A., Lorenzo-Morales,J., Bateman,A., Chiu,C.H., Tang,P., Hegemann,P., Fromm,H., Raoult,D., Greub,G., Miranda-Saavedra,D., Chen,N., Nash,P., Ginger,M.L., Horn,M., Schaap,P., Caler,L. and Loftus,B. TITLE Genome of Acanthamoeba castellanii highlights extensive lateral gene transfer and early evolution of tyrosine kinase signaling JOURNAL Genome Biol. 14 (2), R11 (2013) PUBMED 23375108 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 283) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (06-OCT-2021) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 283) AUTHORS Clarke,M., Zafar,N., Loftus,B. and Caler,E. TITLE Direct Submission JOURNAL Submitted (24-OCT-2012) J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, USA COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_004457380). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..283 /organism="Acanthamoeba castellanii str. Neff" /mol_type="mRNA" /strain="Neff" /isolation_source="pond" /culture_collection="ATCC:30010" /db_xref="taxon:1257118" /chromosome="Unknown" /country="USA" /collection_date="1960" gene <1..>283 /locus_tag="ACA1_213090" /db_xref="GeneID:14915852" CDS 1..>283 /locus_tag="ACA1_213090" /note="encoded by transcript ACA1_213090A" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_004337045.1" /db_xref="GeneID:14915852" /translation="
MALAIAVAALNRERAGAGVGEAEERRARALAAAMVAWAEGQAAQLMTTPATDDGREVGRPPRHNFCFKCGAALHSAATFCADCGVKLPREGDTE"
ORIGIN
atggcgctggccatcgccgtggccgcgctcaacagagaacgcgccggcgccggcgttggtgaggcggaggagcggcgggcgcgggcgctggcggcggcgatggtggcgtgggccgagggccaggcggcgcagctgatgacgacgccggcgacggacgacgggcgcgaggtggggcggccgccgcggcacaacttctgcttcaagtgcggcgcggccctgcactcggccgccaccttctgcgccgactgcggcgtcaagctcccgcgcgagggcgacaccgagg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]