2024-04-29 22:50:59, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_004177506 303 bp mRNA linear PLN 15-JUN-2017 DEFINITION Tetrapisispora blattae CBS 6284 hypothetical protein (TBLA0A02360), partial mRNA. ACCESSION XM_004177506 VERSION XM_004177506.1 DBLINK BioProject: PRJNA188088 BioSample: SAMEA2271984 KEYWORDS RefSeq. SOURCE Tetrapisispora blattae CBS 6284 ORGANISM Tetrapisispora blattae CBS 6284 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Tetrapisispora. REFERENCE 1 AUTHORS Gordon,J.L., Armisen,D., Proux-Wera,E., OhEigeartaigh,S.S., Byrne,K.P. and Wolfe,K.H. TITLE Evolutionary erosion of yeast sex chromosomes by mating-type switching accidents JOURNAL Proc. Natl. Acad. Sci. U.S.A. 108 (50), 20024-20029 (2011) PUBMED 22123960 REFERENCE 2 (bases 1 to 303) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-JUN-2017) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 303) AUTHORS Byrne,K. TITLE Direct Submission JOURNAL Submitted (30-APR-2012) Smurfit Institute of Genetics, Trinity College Dublin, College Green, Dublin 2, IRELAND COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_020185). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..303 /organism="Tetrapisispora blattae CBS 6284" /mol_type="mRNA" /strain="type strain:CBS 6284" /db_xref="taxon:1071380" /chromosome="1" gene <1..>303 /gene="TBLA0A02360" /locus_tag="TBLA_0A02360" /db_xref="GeneID:14492785" CDS 1..303 /gene="TBLA0A02360" /locus_tag="TBLA_0A02360" /inference="similar to DNA sequence:INSDC:YMR194W,YPL249C-A" /note="similar to Saccharomyces cerevisiae RPL36A (YMR194W) and RPL36B (YPL249C-A); ancestral locus Anc_6.283" /codon_start=1 /product="hypothetical protein" /protein_id="XP_004177554.1" /db_xref="GeneID:14492785" /db_xref="GOA:I2GV83" /db_xref="InterPro:IPR000509" /db_xref="UniProtKB/TrEMBL:I2GV83" /translation="
MAVKTGIAVGLNKGKQVVSMTPAAKISYKKGQSSQRTKFVRSLVREIAGLAPYERRLIDLIRNAGEKRARKVAKKRLGSFTRAKAKVEEMNNIIAASRRH"
misc_feature 13..297 /gene="TBLA0A02360" /locus_tag="TBLA_0A02360" /note="Ribosomal protein L36e; Region: Ribosomal_L36e; pfam01158" /db_xref="CDD:426088" ORIGIN
atggctgtcaaaactggtattgctgttggtttgaacaaaggtaagcaggtcgtctctatgaccccagctgccaagatctcatacaagaagggccaatcttctcaaagaaccaagttcgtcagatctttggtcagagaaatcgctggtttagctccatacgaaagaagattgatcgatttgatcagaaacgccggtgaaaagagagccagaaaggtcgccaagaagagattgggttctttcaccagagccaaggctaaggttgaagaaatgaacaacatcattgctgcctctcgtcgtcattag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]