LOCUS       XM_003836679             285 bp    mRNA    linear   PLN 28-AUG-2017
DEFINITION  Leptosphaeria maculans JN3 predicted protein (LEMA_uP042630.1),
            partial mRNA.
ACCESSION   XM_003836679
VERSION     XM_003836679.1
DBLINK      BioProject: PRJNA171003
KEYWORDS    RefSeq.
SOURCE      Plenodomus lingam JN3
  ORGANISM  Plenodomus lingam JN3
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Dothideomycetes; Pleosporomycetidae; Pleosporales; Pleosporineae;
            Leptosphaeriaceae; Plenodomus; Plenodomus lingam/Leptosphaeria
            maculans species complex.
REFERENCE   1  (bases 1 to 285)
  AUTHORS   Rouxel,T., Grandaubert,J., Hane,J.K., Hoede,C., van de Wouw,A.P.,
            Couloux,A., Dominguez,V., Anthouard,V., Bally,P., Bourras,S.,
            Cozijnsen,A.J., Ciuffetti,L.M., Degrave,A., Dilmaghani,A.,
            Duret,L., Fudal,I., Goodwin,S.B., Gout,L., Glaser,N., Linglin,J.,
            Kema,G.H., Lapalu,N., Lawrence,C.B., May,K., Meyer,M., Ollivier,B.,
            Poulain,J., Schoch,C.L., Simon,A., Spatafora,J.W., Stachowiak,A.,
            Turgeon,B.G., Tyler,B.M., Vincent,D., Weissenbach,J., Amselem,J.,
            Quesneville,H., Oliver,R.P., Wincker,P., Balesdent,M.H. and
            Howlett,B.J.
  TITLE     Effector diversification within compartments of the Leptosphaeria
            maculans genome affected by Repeat-Induced Point mutations
  JOURNAL   Nat Commun 2, 202 (2011)
   PUBMED   21326234
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 285)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (28-AUG-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 285)
  AUTHORS   Genoscope -,C.E.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-MAR-2010) to the INSDC. Genoscope - Centre National
            de Sequencage : BP 191 91006 EVRY cedex -FRANCE (E-mail :
            seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr)
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_003533850).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..285
                     /organism="Plenodomus lingam JN3"
                     /mol_type="mRNA"
                     /isolate="v23.1.3"
                     /db_xref="taxon:985895"
                     /chromosome="Unknown"
     gene            <1..>285
                     /locus_tag="LEMA_uP042630.1"
                     /db_xref="GeneID:13282994"
     CDS             1..285
                     /locus_tag="LEMA_uP042630.1"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_003836727.1"
                     /db_xref="GeneID:13282994"
                     /db_xref="UniProtKB/TrEMBL:E4ZNZ3"
                     /translation="

MSLMPFRVRLGMSLHLRLHQQHPSLHHRSSIHITTDNSEHPLYWMSNQFTWTLPAGPLLVSGSAPSHQGINFSVGSCSWVFPTEYSVGTTARER"

ORIGIN      

atgtctctcatgccttttcgggttagactgggaatgtctttgcatcttcgccttcaccagcagcatccatccttacaccatcggtccagcatccacattaccacggacaactccgaacacccgctctattggatgtcaaaccaatttacctggactttgccagctggcccactcctagtttcggggtccgctccgtcacaccaaggcatcaatttttctgtaggtagttgctcctgggtctttcctacggagtactctgtaggtacaacagcacgtgaaagatga

//