LOCUS       XM_002880852             576 bp    mRNA    linear   PLN 11-MAY-2017
DEFINITION  PREDICTED: Arabidopsis lyrata subsp. lyrata protein CLAVATA 3
            (LOC9315145), mRNA.
ACCESSION   XM_002880852
VERSION     XM_002880852.2
DBLINK      BioProject: PRJNA49545
KEYWORDS    RefSeq.
SOURCE      Arabidopsis lyrata subsp. lyrata
  ORGANISM  Arabidopsis lyrata subsp. lyrata
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_003302552.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 11, 2017 this sequence version replaced XM_002880852.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Arabidopsis lyrata subsp. lyrata
                                           Annotation Release 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 7.4
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..576
                     /organism="Arabidopsis lyrata subsp. lyrata"
                     /mol_type="mRNA"
                     /sub_species="lyrata"
                     /bio_material="NASC:donor number MN47"
                     /db_xref="taxon:81972"
                     /chromosome="Unknown"
     gene            1..576
                     /gene="LOC9315145"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 Proteins, and 86% coverage of
                     the annotated genomic feature by RNAseq alignments"
                     /db_xref="GeneID:9315145"
     CDS             125..406
                     /gene="LOC9315145"
                     /codon_start=1
                     /product="protein CLAVATA 3"
                     /protein_id="XP_002880898.1"
                     /db_xref="GeneID:9315145"
                     /translation="

MDSRSLVLLLLFCLLFLHDASDLTHANAHIHGLPSRKMMKMEREWVGANGEEEKAKKKGLGLHEELRTVPSGPDPLHHHVNPPRQPRNQSNIP"

ORIGIN      

ttctcgtgcttgtaggcttacgctataaattggactgtccccttctcatttcattaccaaagtaaagaacagtttctatctttctctctttatctctctcactcactcactttctctctaaaaaatggattcaagaagtcttgtgctactcctactcttctgcctcttgttccttcatgatgcttctgatctcactcacgctaatgctcacattcatggacttccctcccgcaagatgatgaagatggagagggaatgggtaggagctaatggagaagaagagaaggcgaagaagaagggtttaggactacatgaagagctaaggactgttccttcaggacctgacccgttgcaccatcatgtgaacccaccaagacagccaagaaaccaatctaatatcccttgacctaatcttgttccttttacttatttcatgttgtaaattactttctgttttatcggttttatcattttgggagttttgtttttgtgtaaccagtttcgtttgctaagcttgtagtttcatgaaagtgaatgtaagatatgcactacttttgttgctcacgttaatgaaat

//