GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-18 18:16:51, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_001879458             411 bp    mRNA    linear   PLN 13-NOV-2023
DEFINITION  Laccaria bicolor S238N-H82 uncharacterized protein
            (LACBIDRAFT_325715), partial mRNA.
ACCESSION   XM_001879458
VERSION     XM_001879458.1
DBLINK      BioProject: PRJNA29019
            BioSample: SAMN02769624
KEYWORDS    RefSeq.
SOURCE      Laccaria bicolor S238N-H82
  ORGANISM  Laccaria bicolor S238N-H82
            Eukaryota; Fungi; Dikarya; Basidiomycota; Agaricomycotina;
            Agaricomycetes; Agaricomycetidae; Agaricales; Agaricineae;
            Hydnangiaceae; Laccaria.
REFERENCE   1  (bases 1 to 411)
  AUTHORS   Martin,F., Aerts,A., Ahren,D., Brun,A., Danchin,E.G.,
            Duchaussoy,F., Gibon,J., Kohler,A., Lindquist,E., Pereda,V.,
            Salamov,A., Shapiro,H.J., Wuyts,J., Blaudez,D., Buee,M.,
            Brokstein,P., Canback,B., Cohen,D., Courty,P.E., Coutinho,P.M.,
            Delaruelle,C., Detter,J.C., Deveau,A., DiFazio,S., Duplessis,S.,
            Fraissinet-Tachet,L., Lucic,E., Frey-Klett,P., Fourrey,C.,
            Feussner,I., Gay,G., Grimwood,J., Hoegger,P.J., Jain,P., Kilaru,S.,
            Labbe,J., Lin,Y.C., Legue,V., Le Tacon,F., Marmeisse,R.,
            Melayah,D., Montanini,B., Muratet,M., Nehls,U., Niculita-Hirzel,H.,
            Oudot-Le Secq,M.P., Peter,M., Quesneville,H., Rajashekar,B.,
            Reich,M., Rouhier,N., Schmutz,J., Yin,T., Chalot,M., Henrissat,B.,
            Kues,U., Lucas,S., Van de Peer,Y., Podila,G.K., Polle,A.,
            Pukkila,P.J., Richardson,P.M., Rouze,P., Sanders,I.R.,
            Stajich,J.E., Tunlid,A., Tuskan,G. and Grigoriev,I.V.
  TITLE     The genome of Laccaria bicolor provides insights into mycorrhizal
            symbiosis
  JOURNAL   Nature 452 (7183), 88-92 (2008)
   PUBMED   18322534
REFERENCE   2  (bases 1 to 411)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (12-NOV-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 411)
  AUTHORS   Zhou,K., Detter,J.C., Glavina del Rio,T., Dahlen,E., Tice,H.,
            Pitluck,S., Aerts,A., Salamov,A., Shapiro,H.J., Lindquist,E.,
            Lucas,S., Richardson,P.M., Ahren,D., Blaudez,D., Brun,A., Buee,M.,
            Chalot,M., Courty,P., Coutinho,P.M., Deveau,A., Duplessis,S.,
            Duchaussoy,F., Fourrey,C., Fraissinet-Tachet,L., Henrissat,B.,
            Gay,G., Gibon,J., Hoegger,P., Kohler,A., Kues,U., Labbe,J.,
            Muratet,M., Marmeisse,R., Melayah,D., Montanini,B., Napoli,C.,
            Podila,G., Reich,M., Rouhier,N., Rouze,P., Wuyts,J., Martin,F. and
            Grigoriev,I.V.
  CONSRTM   US DOE Joint Genome Institute (JGI-PGF)
  TITLE     Direct Submission
  JOURNAL   Submitted (19-NOV-2007) US DOE Joint Genome Institute, 2800
            Mitchell Drive B100, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_001889879).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..411
                     /organism="Laccaria bicolor S238N-H82"
                     /mol_type="mRNA"
                     /strain="S238N-H82"
                     /db_xref="taxon:486041"
                     /chromosome="Unknown"
     gene            <1..>411
                     /locus_tag="LACBIDRAFT_325715"
                     /db_xref="GeneID:6074951"
     CDS             1..411
                     /locus_tag="LACBIDRAFT_325715"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_001879493.1"
                     /db_xref="GeneID:6074951"
                     /translation="
MYSRSPWPVASPAAPLSSGNQSLLVIHGELPLASVLKYLDENCVDETNIVDGDTDVVNGDADVVNGDADVVNGDTDVDGDVDVVGVDTDGGTDVVDDDTNGGTDVVDGGTDTVGGDTDVEVEQSVRRPGREMIARA"
ORIGIN      
atgtactctcggtctccatggcctgttgcatctcctgctgcaccactctcaagtggtaatcaatctcttcttgtcattcacggcgaacttcctcttgcctctgttctcaagtatttggatgagaattgtgtcgatgagaccaacattgtcgatggtgacacagacgtcgtcaatggtgacgcagacgtcgtcaatggtgacgcagatgtcgtcaatggtgacacagacgtcgacggtgatgtagacgtcgtcggtgttgacacagatggtggcacagacgtcgtcgatgatgacacaaatggtggcacagacgttgttgatggtggcacagacactgttggaggtgacacagacgtcgaggttgagcaaagtgtgagacgccctggaagggagatgattgcaagagcgtag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]