GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-19 04:16:19, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_001628563            1194 bp    mRNA    linear   INV 21-JUN-2022
DEFINITION  PREDICTED: Nematostella vectensis spidroin-2 (LOC5508030), mRNA.
ACCESSION   XM_001628563
VERSION     XM_001628563.3
DBLINK      BioProject: PRJNA847078
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Nematostella vectensis (starlet sea anemone)
  ORGANISM  Nematostella vectensis
            Eukaryota; Metazoa; Cnidaria; Anthozoa; Hexacorallia; Actiniaria;
            Edwardsiidae; Nematostella.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_064040) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Jun 21, 2022 this sequence version replaced XM_001628563.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Nematostella vectensis Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 9.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 38% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1194
                     /organism="Nematostella vectensis"
                     /mol_type="mRNA"
                     /db_xref="taxon:45351"
                     /chromosome="7"
     gene            1..1194
                     /gene="LOC5508030"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 61% coverage of the annotated
                     genomic feature by RNAseq alignments, including 16 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:5508030"
     CDS             1..1194
                     /gene="LOC5508030"
                     /codon_start=1
                     /product="spidroin-2"
                     /protein_id="XP_001628613.3"
                     /db_xref="GeneID:5508030"
                     /translation="
MWMYSRNHTQQGKQCPCIMTGPTQQGNQCPCNMAGPTQQGNQCPCNMAGPTQQGKQCPCVMPGPTQQGKQCPCNMAGPTQQRNQCPCNMAGPIQQGNQFPCNMAGPTQQGNQCPCNMADPTQQGNKCPCVMPGPTQQGKQCPCNMAEPTQQGKQCPCNMAGPTQQGNQFPCNMAGPTQQGKQCPCVMAGPTQQGNQCPCNMAGPTQQGNQCPCNMAGPTQQGNHCPCNMAGPTQQGNQFPCNMAGPTQQGNQCHYNMADSTQHDEQCHVVVGFMTADKAASNIHLSSEEVCARFLGQLDTIFGTPEDPRPASDNLVNYVYYHWSKHPYVRGGYSSPTALAHGLRHHLASPVSGRLFFAGEATNVKVSATVPSAIEWGESGGGGATASIEELSAEGTH"
     misc_feature    <298..648
                     /gene="LOC5508030"
                     /note="60S ribosomal protein L19-like protein;
                     Provisional; Region: PTZ00436"
                     /db_xref="CDD:185616"
     misc_feature    <748..1125
                     /gene="LOC5508030"
                     /note="Flavin containing amine oxidoreductase; Region:
                     Amino_oxidase; pfam01593"
                     /db_xref="CDD:396255"
ORIGIN      
atgtggatgtattccaggaatcacacccaacaagggaagcagtgcccctgtatcatgactggccccacccaacaagggaaccagtgcccctgtaacatggctggccccacccaacaagggaaccagtgcccctgtaacatggctggccccacccaacaagggaagcagtgcccctgtgtcatgcctggccccacccaacaagggaagcagtgcccctgtaacatggctggccccacccaacaaaggaaccagtgcccctgtaacatggctggccccatccaacaagggaaccagttcccctgtaacatggctggccccacccaacaagggaaccagtgcccctgtaacatggctgaccccacccaacaagggaacaagtgcccctgtgtcatgcctggccccacccaacaagggaagcagtgcccctgtaacatggctgaacccacccaacaagggaagcagtgcccctgtaacatggctggccccacccaacaagggaaccagttcccctgtaacatggctggccccacccaacaagggaagcagtgcccctgtgtcatggctggcccaacccaacaaggaaaccagtgcccctgtaacatggctggccccacccaacaaggaaaccagtgcccctgtaacatggctggccccacccaacaagggaaccattgcccctgtaacatggctggccccacccaacaagggaaccagttcccctgtaacatggctggccccacccaacaagggaaccagtgccattataacatggctgactccacccaacatgatgaacagtgtcacgtggttgtgggttttatgaccgctgacaaggcggcatcgaatattcacctgtctagtgaagaagtgtgtgccagattcctggggcaactggataccatttttgggacccctgaggacccccgaccagcctctgacaacctggtcaactacgtgtactatcattggtccaaacacccctacgtcagaggtggctacagcagtccgactgcgcttgcgcacggcctacggcaccatctagctagtccggtcagcggtcgactgtttttcgcgggagaggcaacgaatgtcaaggtctctgccaccgtcccttcggcgatagagtggggagagagcggcggagggggtgctacagcaagcattgaggagttgtcagcggagggtacccattaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]