LOCUS       NM_201638               2625 bp    mRNA    linear   ROD 25-DEC-2023
DEFINITION  Mus musculus methyltransferase 14, N6-adenosine-methyltransferase
            subunit (Mettl14), mRNA.
ACCESSION   NM_201638 XM_131193
VERSION     NM_201638.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 2625)
  AUTHORS   Zheng Y, Zhang Z, Zheng D, Yi P and Wang S.
  TITLE     METTL14 promotes the development of diabetic kidney disease by
            regulating m6A modification of TUG1
  JOURNAL   Acta Diabetol 60 (11), 1567-1580 (2023)
   PUBMED   37428236
  REMARK    GeneRIF: METTL14 promotes the development of diabetic kidney
            disease by regulating m[6]A modification of TUG1.
REFERENCE   2  (bases 1 to 2625)
  AUTHORS   Kang Q, Zhu X, Ren D, Ky A, MacDougald OA, O'Rourke RW and Rui L.
  TITLE     Adipose METTL14-Elicited N6 -Methyladenosine Promotes Obesity,
            Insulin Resistance, and NAFLD Through Suppressing beta Adrenergic
            Signaling and Lipolysis
  JOURNAL   Adv Sci (Weinh) 10 (28), e2301645 (2023)
   PUBMED   37526326
  REMARK    GeneRIF: Adipose METTL14-Elicited N[6] -Methyladenosine Promotes
            Obesity, Insulin Resistance, and NAFLD Through Suppressing beta
            Adrenergic Signaling and Lipolysis.
REFERENCE   3  (bases 1 to 2625)
  AUTHORS   Kobayashi R, Kawabata-Iwakawa R, Terakawa J, Sugiyama M, Morita S,
            Horii T and Hatada I.
  TITLE     Aberrant activation of estrogen receptor-alpha signaling in
            Mettl14-deficient uteri impairs embryo implantation
  JOURNAL   FASEB J 37 (8), e23093 (2023)
   PUBMED   37440278
  REMARK    GeneRIF: Aberrant activation of estrogen receptor-alpha signaling
            in Mettl14-deficient uteri impairs embryo implantation.
REFERENCE   4  (bases 1 to 2625)
  AUTHORS   Mu M, Li X, Dong L, Wang J, Cai Q, Hu Y, Wang D, Zhao P, Zhang L,
            Zhang D, Cheng S, Tan L, Wu F, Shi YG, Xu W, Shi Y and Shen H.
  TITLE     METTL14 regulates chromatin bivalent domains in mouse embryonic
            stem cells
  JOURNAL   Cell Rep 42 (6), 112650 (2023)
   PUBMED   37314930
  REMARK    GeneRIF: METTL14 regulates chromatin bivalent domains in mouse
            embryonic stem cells.
            Erratum:[Cell Rep. 2023 Sep 6;42(9):113116. PMID: 37676772]
REFERENCE   5  (bases 1 to 2625)
  AUTHORS   Gao J, Chen H, Zhang Y, Yu S, Wu Y, Wang Q and Yu Z.
  TITLE     METTL14 knockdown inhibits the pyroptosis in the sepsis-induced
            acute lung injury through regulating the m6A modification of NLRP3
  JOURNAL   Exp Lung Res 49 (1), 220-230 (2023)
   PUBMED   38047519
  REMARK    GeneRIF: METTL14 knockdown inhibits the pyroptosis in the
            sepsis-induced acute lung injury through regulating the m6A
            modification of NLRP3.
REFERENCE   6  (bases 1 to 2625)
  AUTHORS   Wang Y, Li Y, Toth JI, Petroski MD, Zhang Z and Zhao JC.
  TITLE     N6-methyladenosine modification destabilizes developmental
            regulators in embryonic stem cells
  JOURNAL   Nat Cell Biol 16 (2), 191-198 (2014)
   PUBMED   24394384
REFERENCE   7  (bases 1 to 2625)
  AUTHORS   Okazaki N, Kikuno R, Ohara R, Inamoto S, Koseki H, Hiraoka S, Saga
            Y, Nagase T, Ohara O and Koga H.
  TITLE     Prediction of the coding sequences of mouse homologues of KIAA
            gene: III. the complete nucleotide sequences of 500 mouse
            KIAA-homologous cDNAs identified by screening of terminal sequences
            of cDNA clones randomly sampled from size-fractionated libraries
  JOURNAL   DNA Res 10 (4), 167-180 (2003)
   PUBMED   14621295
REFERENCE   8  (bases 1 to 2625)
  AUTHORS   Mu X, Zhao S, Pershad R, Hsieh TF, Scarpa A, Wang SW, White RA,
            Beremand PD, Thomas TL, Gan L and Klein WH.
  TITLE     Gene expression in the developing mouse retina by EST sequencing
            and microarray analysis
  JOURNAL   Nucleic Acids Res 29 (24), 4983-4993 (2001)
   PUBMED   11812828
REFERENCE   9  (bases 1 to 2625)
  AUTHORS   Piao Y, Ko NT, Lim MK and Ko MS.
  TITLE     Construction of long-transcript enriched cDNA libraries from
            submicrogram amounts of total RNAs by a universal PCR amplification
            method
  JOURNAL   Genome Res 11 (9), 1553-1558 (2001)
   PUBMED   11544199
REFERENCE   10 (bases 1 to 2625)
  AUTHORS   Huttenhofer A, Kiefmann M, Meier-Ewert S, O'Brien J, Lehrach H,
            Bachellerie JP and Brosius J.
  TITLE     RNomics: an experimental approach that identifies 201 candidates
            for novel, small, non-messenger RNAs in mouse
  JOURNAL   EMBO J 20 (11), 2943-2953 (2001)
   PUBMED   11387227
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            BE448358.1, AK146881.1, BI990545.1 and BM247306.2.
            
            On Sep 30, 2009 this sequence version replaced NM_201638.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AK146881.1, BC052204.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN01164142 [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-12                BE448358.1         119-130
            13-1620             AK146881.1         2-1609
            1621-2048           BI990545.1         173-600
            2049-2625           BM247306.2         1-577               c
FEATURES             Location/Qualifiers
     source          1..2625
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10090"
                     /chromosome="3"
                     /map="3 53.96 cM"
     gene            1..2625
                     /gene="Mettl14"
                     /gene_synonym="G430022H21Rik; mKIAA1627"
                     /note="methyltransferase 14,
                     N6-adenosine-methyltransferase subunit"
                     /db_xref="GeneID:210529"
                     /db_xref="MGI:MGI:2442926"
     exon            1..229
                     /gene="Mettl14"
                     /gene_synonym="G430022H21Rik; mKIAA1627"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    44..46
                     /gene="Mettl14"
                     /gene_synonym="G430022H21Rik; mKIAA1627"
                     /note="upstream in-frame stop codon"
     CDS             164..1534
                     /gene="Mettl14"
                     /gene_synonym="G430022H21Rik; mKIAA1627"
                     /EC_number="2.1.1.62"
                     /note="methyltransferase-like protein 14; snoRNA MBII-84;
                     N6-adenosine-methyltransferase subunit METTL14;
                     methyltransferase like 14"
                     /codon_start=1
                     /product="N6-adenosine-methyltransferase non-catalytic
                     subunit"
                     /protein_id="NP_964000.2"
                     /db_xref="CCDS:CCDS38622.1"
                     /db_xref="GeneID:210529"
                     /db_xref="MGI:MGI:2442926"
                     /translation="

MDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNSKRKCLDEGETDEDKVEEYKDELEMQQEEENLPYEEEIYKDSSTFLKGTQSLNPHNDYCQHFVDTGHRPQNFIRDVGLADRFEEYPKLRELIRLKDELIAKSNTPPMYLQADIEAFDIRELTPKFDVILLEPPLEEYYRETGITANEKCWTWDDIMKLEIDEIAAPRSFIFLWCGSGEGLDLGRVCLRKWGYRRCEDICWIKTNKNNPGKTKTLDPKAVFQRTKEHCLMGIKGTVKRSTDGDFIHANVDIDLIITEEPEIGNIEKPVEIFHIIEHFCLGRRRLHLFGRDSTIRPGWLTVGPTLTNSNYNAETYASYFSAPNSYLTGCTEEIERLRPKSPPPKSKSDRGGGAPRGGGRGGTSAGRGRERNRSNFRGERGGFRGGRGGTHRGGFTPR"

     misc_feature    311..388
                     /gene="Mettl14"
                     /gene_synonym="G430022H21Rik; mKIAA1627"
                     /note="propagated from UniProtKB/Swiss-Prot (Q3UIK4.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    566..571
                     /gene="Mettl14"
                     /gene_synonym="G430022H21Rik; mKIAA1627"
                     /note="propagated from UniProtKB/Swiss-Prot (Q3UIK4.1);
                     Region: Interaction with METTL3.
                     /evidence=ECO:0000250|UniProtKB:Q9HCE5"
     misc_feature    599..601
                     /gene="Mettl14"
                     /gene_synonym="G430022H21Rik; mKIAA1627"
                     /note="Interaction with METTL3.
                     /evidence=ECO:0000250|UniProtKB:Q9HCE5; propagated from
                     UniProtKB/Swiss-Prot (Q3UIK4.1); other site"
     misc_feature    719..1252
                     /gene="Mettl14"
                     /gene_synonym="G430022H21Rik; mKIAA1627"
                     /note="Region: MT-A70; pfam05063"
                     /db_xref="CDD:368270"
     misc_feature    872..877
                     /gene="Mettl14"
                     /gene_synonym="G430022H21Rik; mKIAA1627"
                     /note="propagated from UniProtKB/Swiss-Prot (Q3UIK4.1);
                     Region: Interaction with METTL3.
                     /evidence=ECO:0000250|UniProtKB:Q9HCE5"
     misc_feature    887..889
                     /gene="Mettl14"
                     /gene_synonym="G430022H21Rik; mKIAA1627"
                     /note="Interaction with METTL3.
                     /evidence=ECO:0000250|UniProtKB:Q9HCE5; propagated from
                     UniProtKB/Swiss-Prot (Q3UIK4.1); other site"
     misc_feature    896..925
                     /gene="Mettl14"
                     /gene_synonym="G430022H21Rik; mKIAA1627"
                     /note="propagated from UniProtKB/Swiss-Prot (Q3UIK4.1);
                     Region: Positively charged region required for
                     RNA-binding. /evidence=ECO:0000250|UniProtKB:Q9HCE5"
     misc_feature    896..898
                     /gene="Mettl14"
                     /gene_synonym="G430022H21Rik; mKIAA1627"
                     /note="Interaction with METTL3.
                     /evidence=ECO:0000250|UniProtKB:Q9HCE5; propagated from
                     UniProtKB/Swiss-Prot (Q3UIK4.1); other site"
     misc_feature    926..937
                     /gene="Mettl14"
                     /gene_synonym="G430022H21Rik; mKIAA1627"
                     /note="propagated from UniProtKB/Swiss-Prot (Q3UIK4.1);
                     Region: Interaction with METTL3.
                     /evidence=ECO:0000250|UniProtKB:Q9HCE5"
     misc_feature    995..1024
                     /gene="Mettl14"
                     /gene_synonym="G430022H21Rik; mKIAA1627"
                     /note="propagated from UniProtKB/Swiss-Prot (Q3UIK4.1);
                     Region: Interaction with METTL3.
                     /evidence=ECO:0000250|UniProtKB:Q9HCE5"
     misc_feature    1052..1057
                     /gene="Mettl14"
                     /gene_synonym="G430022H21Rik; mKIAA1627"
                     /note="propagated from UniProtKB/Swiss-Prot (Q3UIK4.1);
                     Region: Positively charged region required for
                     RNA-binding. /evidence=ECO:0000250|UniProtKB:Q9HCE5"
     misc_feature    1055..1057
                     /gene="Mettl14"
                     /gene_synonym="G430022H21Rik; mKIAA1627"
                     /note="Interaction with METTL3.
                     /evidence=ECO:0000250|UniProtKB:Q9HCE5; propagated from
                     UniProtKB/Swiss-Prot (Q3UIK4.1); other site"
     misc_feature    1085..1099
                     /gene="Mettl14"
                     /gene_synonym="G430022H21Rik; mKIAA1627"
                     /note="propagated from UniProtKB/Swiss-Prot (Q3UIK4.1);
                     Region: Interaction with METTL3.
                     /evidence=ECO:0000250|UniProtKB:Q9HCE5"
     misc_feature    1340..1531
                     /gene="Mettl14"
                     /gene_synonym="G430022H21Rik; mKIAA1627"
                     /note="propagated from UniProtKB/Swiss-Prot (Q3UIK4.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    1358..1360
                     /gene="Mettl14"
                     /gene_synonym="G430022H21Rik; mKIAA1627"
                     /note="Interaction with METTL3.
                     /evidence=ECO:0000250|UniProtKB:Q9HCE5; propagated from
                     UniProtKB/Swiss-Prot (Q3UIK4.1); other site"
     misc_feature    1358..1360
                     /gene="Mettl14"
                     /gene_synonym="G430022H21Rik; mKIAA1627"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:Q9HCE5; propagated from
                     UniProtKB/Swiss-Prot (Q3UIK4.1); phosphorylation site"
     exon            230..318
                     /gene="Mettl14"
                     /gene_synonym="G430022H21Rik; mKIAA1627"
                     /inference="alignment:Splign:2.1.0"
     exon            319..406
                     /gene="Mettl14"
                     /gene_synonym="G430022H21Rik; mKIAA1627"
                     /inference="alignment:Splign:2.1.0"
     exon            407..487
                     /gene="Mettl14"
                     /gene_synonym="G430022H21Rik; mKIAA1627"
                     /inference="alignment:Splign:2.1.0"
     exon            488..575
                     /gene="Mettl14"
                     /gene_synonym="G430022H21Rik; mKIAA1627"
                     /inference="alignment:Splign:2.1.0"
     exon            576..666
                     /gene="Mettl14"
                     /gene_synonym="G430022H21Rik; mKIAA1627"
                     /inference="alignment:Splign:2.1.0"
     exon            667..808
                     /gene="Mettl14"
                     /gene_synonym="G430022H21Rik; mKIAA1627"
                     /inference="alignment:Splign:2.1.0"
     exon            809..901
                     /gene="Mettl14"
                     /gene_synonym="G430022H21Rik; mKIAA1627"
                     /inference="alignment:Splign:2.1.0"
     exon            902..1018
                     /gene="Mettl14"
                     /gene_synonym="G430022H21Rik; mKIAA1627"
                     /inference="alignment:Splign:2.1.0"
     exon            1019..1229
                     /gene="Mettl14"
                     /gene_synonym="G430022H21Rik; mKIAA1627"
                     /inference="alignment:Splign:2.1.0"
     exon            1230..2625
                     /gene="Mettl14"
                     /gene_synonym="G430022H21Rik; mKIAA1627"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

atagcctgtttcaggcgcgccggaaacttcctcctgagggacgtgaaagtctccgggtcagaatctctgcggggcgggacccggtgtttcctggtttggcaggtggatttgcattttggcgggcgcggagtctgtcggggtggtgagcagccgaagctggggcatggatagccgcctgcaggagatccgggagcggcagaagttacggcggcagctcctagctcagcagttgggagctgagagtgcggatagcattggtgctgtgttaaatagcaaagatgaacagagggagattgctgaaaccagagaaacctgcagggcttcctatgatacatctgctccaaactcaaaacggaagtgtctggatgaaggagagactgatgaagacaaagtagaagaatataaggatgaactggaaatgcagcaggaggaagagaatttgccatatgaagaagagatttacaaagattccagtacctttcttaagggaacgcagagcttaaatccccataatgattactgccaacattttgtagacactggacacagacctcagaatttcatcagggatgtaggtttagctgacagatttgaagaataccctaaacttagggaactcatcagactaaaggatgagttaatagctaagtcaaacactcctcccatgtacttacaagcagacatagaagcctttgacatcagagaattgacacccaaatttgatgtgattctcctggagccccctctggaagaatactatagagagactggcatcactgcgaatgagaaatgctggacctgggatgatattatgaagttagaaatcgatgagattgcagcacctcggtcatttatatttctctggtgcggttctggggaaggattggaccttgggagagtatgcttgcgaaagtggggttacagaagatgtgaagatatttgttggattaaaaccaataaaaacaatcctggaaagacaaagactctagatccaaaggcagttttccagagaacaaaggagcattgcctgatggggatcaaaggaaccgtgaagcgaagcacagacggggacttcattcatgctaatgttgacattgacttaattatcacagaagaacctgagattggcaatatagaaaaaccagtagaaatttttcatataatagaacatttttgtcttggtagaagacgccttcatctctttgggagagatagcactatcaggccaggctggctcacagttggaccaacgcttacaaacagtaactacaatgcagaaacatatgcatcgtatttcagtgcccccaactcatacttgaccggatgtacagaggaaatcgagaggcttcgaccgaagtcacctcctcccaagtccaagtctgaccgtgggggtggagctcccagaggtggaggaagggggggaacatctgctggccgtggtcgggaaagaaaccgatccaatttccgaggagagagaggtggctttagggggggccgtggaggcacgcacagaggcggctttactcctcggtagctcttacacttgcatctttatcacagtggagacttgcttcagagctcactcccagcttgtactttgctttagtttctcatgctgccagaaagatcttagccaccccaccccaccccagggactggcagttgtcacagactgagcttttgctcagggtgggtgagtcacgtgtgcgcaacaccccgacctgacttgactgattccagtcaaggctttggcttcctggaaatggctgcgcagaggcttcggcatctcagaggagtggcaggagtgggtgctgtgttccctgtcatggctgcacggcagcaggaggctgggaacccgggtagaacagaattagagaggtggtcactgtgttgggcctttaatgttttcttgttgaaacactaaaaagagaagagtttttccccttacttttaaattctaaaaaataacatgaagtatcatttgagttcccagaactcgggaggggaaatgaaatctcgttcttccagatcagaatctgaggtggttgcagtcgtcagggtaggtaacgggagaggcaggcagagcatgggatatttcaaacaaaaccaagcttatcataatgtaaattagcggctacagatggctcctgaccatgtgtcttcagaagcaagacaaggcatgtatgtctccaggtcggagtgtgaacctgatcttgggctaacctaagataattcagatttcttagcaaaggcaaaaacagatttggggaggggctggtttaaacggttgagaaaataaaatcttgatgatgaggaaatgacaaacatctttaaagttgttactaaagaaaatttaggtaaaagcaattccagaaaacccttacgaatacagcgtggaagaggacctgcagtgtcctttgattagaactatgtggtgcagaagtcgccgcagggctgatgggcagatctcttggctgtgggaagcttcgtgctgttgcctttctacaccttaagtcctatttgatggatttggatatgccagatgagataatgccaatattgttctgggtaactccttttttattttgctataacttttctaataaaaatttaaacctttgaatt

//