GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-29 23:45:49, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_128283                783 bp    mRNA    linear   PLN 20-OCT-2022
DEFINITION  Arabidopsis thaliana CLAVATA3 (CLV3), mRNA.
ACCESSION   NM_128283
VERSION     NM_128283.2
DBLINK      BioProject: PRJNA116
            BioSample: SAMN03081427
KEYWORDS    RefSeq.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 783)
  AUTHORS   Lin,X., Kaul,S., Rounsley,S., Shea,T.P., Benito,M.I., Town,C.D.,
            Fujii,C.Y., Mason,T., Bowman,C.L., Barnstead,M., Feldblyum,T.V.,
            Buell,C.R., Ketchum,K.A., Lee,J., Ronning,C.M., Koo,H.L.,
            Moffat,K.S., Cronin,L.A., Shen,M., Pai,G., Van Aken,S., Umayam,L.,
            Tallon,L.J., Gill,J.E., Adams,M.D., Carrera,A.J., Creasy,T.H.,
            Goodman,H.M., Somerville,C.R., Copenhaver,G.P., Preuss,D.,
            Nierman,W.C., White,O., Eisen,J.A., Salzberg,S.L., Fraser,C.M. and
            Venter,J.C.
  TITLE     Sequence and analysis of chromosome 2 of the plant Arabidopsis
            thaliana
  JOURNAL   Nature 402 (6763), 761-768 (1999)
   PUBMED   10617197
REFERENCE   2  (bases 1 to 783)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 783)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 783)
  AUTHORS   Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
  CONSRTM   TAIR
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
            Institution, 260 Panama Street, Stanford, CA, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
            This record is derived from an annotated genomic sequence
            (NC_003071).
            
            On Feb 17, 2004 this sequence version replaced NM_128283.1.
FEATURES             Location/Qualifiers
     source          1..783
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="2"
                     /ecotype="Columbia"
     gene            1..783
                     /gene="CLV3"
                     /locus_tag="AT2G27250"
                     /gene_synonym="AtCLV3; CLAVATA3; F12K2.17; F12K2_17"
                     /note="One of the three CLAVATA genes controlling the size
                     of the shoot apical meristem (SAM) in Arabidopsis. Belongs
                     to a large gene family called CLE for
                     CLAVATA3/ESR-related. Encodes a stem cell-specific protein
                     CLV3 presumed to be a precursor of a secreted peptide
                     hormone. The deduced ORF encodes a 96-amino acid protein
                     with an 18-amino acid N-terminal signal peptide. The
                     functional form of CLV3 (MCLV3) was first reported to be a
                     posttranscriptionally modified 12-amino acid peptide, in
                     which two of the three prolines were modified to
                     hydroxyproline (Ito et al., Science 2006, 313:842; Kondo
                     et al., Science 2006, 313:845). Ohyama et al. (2009) later
                     reported that the active mature CLV3 is a 13-amino-acid
                     arabinosylated glycopeptide (Nature Chemical Biology,
                     5:578). CLV3 binds the ectodomain of the CLAVATA1 (CLV1)
                     receptor-kinase. Regulates shoot and floral meristem
                     development. Required for CLAVATA1 receptor-like kinase
                     assembly into a signaling complex that includes KAPP and a
                     Rho-related protein. It restricts its own domain of
                     expression, the central zone (CZ) of the shoot apical
                     meristem (SAM), by preventing differentiation of
                     peripheral zone cells, which surround the CZ, into CZ
                     cells and restricts overall SAM size by a separate,
                     long-range effect on cell division rate. CLE domain of
                     CLV3 is sufficient for function. Results obtained from
                     whole seedlings challenge the concept that the immune
                     receptor FLS2 perceives the meristematic regulatory
                     peptide CLV3p in mesophyll, seedlings, and SAM cells and
                     that CLV3p contributes to SAM immunity against bacterial
                     infection (PMID:22923673)."
                     /db_xref="Araport:AT2G27250"
                     /db_xref="GeneID:817267"
                     /db_xref="TAIR:AT2G27250"
     CDS             299..583
                     /gene="CLV3"
                     /locus_tag="AT2G27250"
                     /gene_synonym="AtCLV3; CLAVATA3; F12K2.17; F12K2_17"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EG434005.1,INSD:EG434004.1,INSD:EG434006.1"
                     /inference="similar to RNA sequence, mRNA:INSD:AY219133.1"
                     /note="CLAVATA3 (CLV3); Has 35333 Blast hits to 34131
                     proteins in 2444 species: Archae - 798; Bacteria - 22429;
                     Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0;
                     Other Eukaryotes - 9610 (source: NCBI BLink)."
                     /codon_start=1
                     /product="CLAVATA3"
                     /protein_id="NP_565641.2"
                     /db_xref="Araport:AT2G27250"
                     /db_xref="GeneID:817267"
                     /db_xref="TAIR:AT2G27250"
                     /translation="
MSGPVQQLFHCFSCHEKYLYILLWCAKHSKMLFNWQMMMMKMESEWVGANGEAEKAKTKGLGLHEELRTVPSGPDPLHHHVNPPRQPRNNFQLP"
ORIGIN      
cactcagtcactttctctctaaaaatggattcgaagagttttctgctactactactactcttctgcttcttgttccttcatgatgcttctggtctcactctctctttcactcctctatatgtctataactcatgtaaatggattcttataagtctcaacataacttttttttgttatttactatttcaccagatctcactcaagctcatgctcacgttcaaggactttccaaccgcaaggttatcttcaacttgtactcattaaggcctctcaatattcatgtgttatgttcatgtagatgtccggtccagttcaacaactgtttcattgctttagttgtcacgagaaatatttgtatatattattatggtgtgcaaaacatagtaaaatgttgttcaattggcagatgatgatgatgaaaatggaaagtgaatgggttggagcaaatggagaagcagagaaggcaaagacgaagggtttaggactacatgaagagttaaggactgttccttcgggacctgacccgttgcaccatcatgtgaacccaccaagacagccaagaaacaactttcagctcccttgacctaatctcttgttgctttaaattatttcatattgtaaattactttctgctttatcggttttaccatttcgggagtcttttttgtgtgcaatctgtttcgtttggtaagcttgtagtttcatgaaagtgaatgtaagatatgcattacgtttgttgctgaagtgaatgtaagatacgcactattatatctcatgattttc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]