2024-04-30 20:14:58, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001420744 850 bp mRNA linear ROD 12-DEC-2023 DEFINITION Mus musculus prostaglandin D2 synthase (brain) (Ptgds), transcript variant 2, mRNA. ACCESSION NM_001420744 XM_006497786 VERSION NM_001420744.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 850) AUTHORS Oh Y, Kasu M, Bottoms CJ, Douglas JC, Sekulovski N, Hayashi K and MacLean Ii JA. TITLE Rhox8 homeobox gene ablation leads to rete testis abnormality and male subfertility in micedagger JOURNAL Biol Reprod 109 (4), 520-532 (2023) PUBMED 37471646 REFERENCE 2 (bases 1 to 850) AUTHORS Qu F, Li W, Xu J, Zhang R, Ke J, Ren X, Meng X, Qin L, Zhang J, Lu F, Zhou X, Luo X, Zhang Z, Wang M, Wu G, Pei D, Chen J, Cui G, Suo S and Peng G. TITLE Three-dimensional molecular architecture of mouse organogenesis JOURNAL Nat Commun 14 (1), 4599 (2023) PUBMED 37524711 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 850) AUTHORS Rossitto M, Dejardin S, Rands CM, Le Gras S, Migale R, Rafiee MR, Neirijnck Y, Pruvost A, Nguyen AL, Bossis G, Cammas F, Le Gallic L, Wilhelm D, Lovell-Badge R, Boizet-Bonhoure B, Nef S and Poulat F. TITLE TRIM28-dependent SUMOylation protects the adult ovary from activation of the testicular pathway JOURNAL Nat Commun 13 (1), 4412 (2022) PUBMED 35906245 REMARK Publication Status: Online-Only REFERENCE 4 (bases 1 to 850) AUTHORS Prokopuk L, Jarred EG, Blucher RO, McLaughlin EA, Stringer JM and Western PS. TITLE An essential role for Polycomb Repressive Complex 2 in the mouse ovary JOURNAL Reproduction 163 (3), 167-182 (2022) PUBMED 35084365 REMARK Publication Status: Online-Only REFERENCE 5 (bases 1 to 850) AUTHORS Zhao L, Thomson E, Ng ET, Longmuss E, Svingen T, Bagheri-Fam S, Quinn A, Harley VR, Harrison LC, Pelosi E and Koopman P. TITLE Functional Analysis of Mmd2 and Related PAQR Genes During Sex Determination in Mice JOURNAL Sex Dev 16 (4), 270-282 (2022) PUBMED 35306493 REFERENCE 6 (bases 1 to 850) AUTHORS Bingham CO 3rd, Murakami M, Fujishima H, Hunt JE, Austen KF and Arm JP. TITLE A heparin-sensitive phospholipase A2 and prostaglandin endoperoxide synthase-2 are functionally linked in the delayed phase of prostaglandin D2 generation in mouse bone marrow-derived mast cells JOURNAL J Biol Chem 271 (42), 25936-25944 (1996) PUBMED 8824228 REFERENCE 7 (bases 1 to 850) AUTHORS Pilz A, Woodward K, Povey S and Abbott C. TITLE Comparative mapping of 50 human chromosome 9 loci in the laboratory mouse JOURNAL Genomics 25 (1), 139-149 (1995) PUBMED 7774911 REFERENCE 8 (bases 1 to 850) AUTHORS Chan P, Simon-Chazottes D, Mattei MG, Guenet JL and Salier JP. TITLE Comparative mapping of lipocalin genes in human and mouse: the four genes for complement C8 gamma chain, prostaglandin-D-synthase, oncogene-24p3, and progestagen-associated endometrial protein map to HSA9 and MMU2 JOURNAL Genomics 23 (1), 145-150 (1994) PUBMED 7829063 REFERENCE 9 (bases 1 to 850) AUTHORS Igarashi M, Nagata A, Toh H, Urade Y and Hayaishi O. TITLE Structural organization of the gene for prostaglandin D synthase in the rat brain JOURNAL Proc Natl Acad Sci U S A 89 (12), 5376-5380 (1992) PUBMED 1608945 REFERENCE 10 (bases 1 to 850) AUTHORS Spies T and DeMars R. TITLE Restored expression of major histocompatibility class I molecules by gene transfer of a putative peptide transporter JOURNAL Nature 351 (6324), 323-324 (1991) PUBMED 2034277 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AL732557.4. On May 5, 2023 this sequence version replaced XM_006497786.5. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: SRR5189685.247044.1, SRR17784651.94640.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN00849381, SAMN01164131 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: full length. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-59 AL732557.4 142783-142841 c 60-234 AL732557.4 142333-142507 c 235-374 AL732557.4 141761-141900 c 375-451 AL732557.4 141606-141682 c 452-568 AL732557.4 140845-140961 c 569-670 AL732557.4 140591-140692 c 671-729 AL732557.4 140060-140118 c 730-850 AL732557.4 139484-139604 c FEATURES Location/Qualifiers source 1..850 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="2" /map="2 17.28 cM" gene 1..850 /gene="Ptgds" /gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3" /note="prostaglandin D2 synthase (brain)" /db_xref="GeneID:19215" /db_xref="MGI:MGI:99261" exon 1..59 /gene="Ptgds" /gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3" /inference="alignment:Splign:2.1.0" exon 60..234 /gene="Ptgds" /gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3" /inference="alignment:Splign:2.1.0" CDS 121..690 /gene="Ptgds" /gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3" /EC_number="5.3.99.2" /note="lipocalin-type prostaglandin-D synthase; prostaglandin-H2 D-isomerase; glutathione-independent PGD synthetase; PGD2 synthase; prostaglandin-D2 synthase; glutathione-independent PGD synthase; prostaglandin D2 synthase (21 kDa, brain)" /codon_start=1 /product="prostaglandin-H2 D-isomerase precursor" /protein_id="NP_001407673.1" /db_xref="GeneID:19215" /db_xref="MGI:MGI:99261" /translation="
MAALRMLWMGLVLLGLLGFPQTPAQGHDTVQPNFQQDKFLGRWYSAGLASNSSWFREKKAVLYMCKTVVAPSTEGGLNLTSTFLRKNQCETKIMVLQPAGAPGHYTYSSPHSGSIHSVSVVEANYDEYALLFSRGTKGPGQDFRMATLYSRTQTLKDELKEKFTTFSKAQGLTEEDIVFLPQPDKCIQE"
sig_peptide 121..192 /gene="Ptgds" /gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3" /inference="COORDINATES: ab initio prediction:SignalP:4.0" mat_peptide 193..687 /gene="Ptgds" /gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3" /product="Prostaglandin-H2 D-isomerase. /id=PRO_0000017947" /note="propagated from UniProtKB/Swiss-Prot (O09114.1)" misc_feature 193..195 /gene="Ptgds" /gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3" /note="Pyrrolidone carboxylic acid. /evidence=ECO:0000250|UniProtKB:P22057; propagated from UniProtKB/Swiss-Prot (O09114.1); pyrrolidone-carboxylic-acid site" misc_feature 208..684 /gene="Ptgds" /gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3" /note="lipocalin-type prostaglandin D synthase; Region: lipocalin_L-PGDS; cd19419" /db_xref="CDD:381194" misc_feature order(235..237,247..249,253..255,271..276,280..285, 292..297,304..306,310..312,319..321,325..327,349..351, 355..357,361..363,367..369,394..402,406..408,433..435, 439..441,454..456,466..468,472..474,478..480,505..507, 511..513,517..519,553..555,559..561,565..567) /gene="Ptgds" /gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3" /note="ligand binding cavity [chemical binding]; other site" /db_xref="CDD:381194" misc_feature 271..273 /gene="Ptgds" /gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3" /note="N-linked (GlcNAc...) asparagine. /evidence=ECO:0000250; propagated from UniProtKB/Swiss-Prot (O09114.1); glycosylation site" misc_feature 352..354 /gene="Ptgds" /gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3" /note="N-linked (GlcNAc...) asparagine. /evidence=ECO:0000250; propagated from UniProtKB/Swiss-Prot (O09114.1); glycosylation site" exon 235..374 /gene="Ptgds" /gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3" /inference="alignment:Splign:2.1.0" exon 375..451 /gene="Ptgds" /gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3" /inference="alignment:Splign:2.1.0" exon 452..568 /gene="Ptgds" /gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3" /inference="alignment:Splign:2.1.0" exon 569..670 /gene="Ptgds" /gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3" /inference="alignment:Splign:2.1.0" exon 671..729 /gene="Ptgds" /gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3" /inference="alignment:Splign:2.1.0" exon 730..850 /gene="Ptgds" /gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3" /inference="alignment:Splign:2.1.0" ORIGIN
agattttccagcagcagggaagcgccagagtacacacccggcaccatccccactgtgagttttccttgctttgtccacattgctggcatcaggcccaggcacctgctctgctctgagcaaatggctgctcttcgcatgctgtggatgggtttggtcctcctgggtctcttgggattcccacagaccccagcccagggccatgacacagtgcagcccaactttcaacaagacaagttcctggggcgctggtacagcgcgggcctcgcctccaactcaagctggttccgggagaagaaagctgtattgtatatgtgcaagacagtggtagccccctccacagaaggcggcctcaatctcacctctaccttcctcaggaaaaaccagtgtgagaccaagatcatggtactgcagcctgcgggggctcctggacactacacctacagcagcccccactcgggcagcatccactccgtgtcagtggtggaggccaactatgacgagtacgctctgctattcagcagaggcaccaagggcccaggccaggacttccgcatggccaccctctacagcagaacccagactctgaaggacgagctgaaggagaaattcaccacctttagcaaggcccagggcctcacagaggaggacattgttttcctgccccaaccggataagtgcattcaagagtaaacgcaggtgagagaagtcagtcagagggctggtcacatggtgacctggcctcaggactcctttgctctgtcactctcaagatcccagccctggctccccaaagtacctctacaccctccagctttgccttgacaaagaaataaaagtccaaagcaagtca
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]