LOCUS       NM_001400468             842 bp    mRNA    linear   PLN 23-FEB-2022
DEFINITION  Glycine max uncharacterized LOC100306572 (LOC100306572), transcript
            variant 2, mRNA.
ACCESSION   NM_001400468 XM_006600065
VERSION     NM_001400468.1
KEYWORDS    RefSeq.
SOURCE      Glycine max (soybean)
  ORGANISM  Glycine max
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50
            kb inversion clade; NPAAA clade; indigoferoid/millettioid clade;
            Phaseoleae; Glycine; Glycine subgen. Soja.
REFERENCE   1  (bases 1 to 842)
  AUTHORS   Sha AH, Li C, Yan XH, Shan ZH, Zhou XA, Jiang ML, Mao H, Chen B,
            Wan X and Wei WH.
  TITLE     Large-scale sequencing of normalized full-length cDNA library of
            soybean seed at different developmental stages and analysis of the
            gene expression profiles based on ESTs
  JOURNAL   Mol Biol Rep 39 (3), 2867-2874 (2012)
   PUBMED   21667246
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            HO038767.1, FK644821.1 and FG997135.1.
            
            On Jan 25, 2022 this sequence version replaced XM_006600065.4.
            
            Transcript Variant: This variant (2) has the short second exon and
            the short fourth exon. It encodes the long protein.
            
            ##Evidence-Data-START##
            Transcript exon combination :: SRR12327382.4279569.1,
                                           SRR12327364.707598.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN09064559, SAMN12210912
                                           [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-47                HO038767.1         5-51
            48-250              FK644821.1         32-234              c
            251-541             HO038767.1         274-564
            542-842             FG997135.1         14-314              c
FEATURES             Location/Qualifiers
     source          1..842
                     /organism="Glycine max"
                     /mol_type="mRNA"
                     /db_xref="taxon:3847"
                     /chromosome="17"
                     /map="17"
     gene            1..842
                     /gene="LOC100306572"
                     /note="uncharacterized LOC100306572"
                     /db_xref="GeneID:100306572"
     exon            1..91
                     /gene="LOC100306572"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    26..28
                     /gene="LOC100306572"
                     /note="upstream in-frame stop codon"
     exon            92..225
                     /gene="LOC100306572"
                     /inference="alignment:Splign:2.1.0"
     CDS             110..472
                     /gene="LOC100306572"
                     /note="isoform 1 is encoded by transcript variant 2"
                     /codon_start=1
                     /product="uncharacterized protein LOC100306572 isoform 1"
                     /protein_id="NP_001387397.1"
                     /db_xref="GeneID:100306572"
                     /translation="

MAGPFELGSSKKKPGDGVNDLLTFNAENMQSNMKIIYYSRTFLSIIGGVVAGILGFTSLKGFVFYFLLMMVTSLGLVAKARFSIHSYFDSSNRVLLDGFLGGLMSFVLFWTFAFDIVHIF"

     misc_feature    212..442
                     /gene="LOC100306572"
                     /note="Rab5-interacting protein (Rab5ip); Region: Rab5ip;
                     pfam07019"
                     /db_xref="CDD:429250"
     exon            226..421
                     /gene="LOC100306572"
                     /inference="alignment:Splign:2.1.0"
     exon            422..441
                     /gene="LOC100306572"
                     /inference="alignment:Splign:2.1.0"
     exon            442..842
                     /gene="LOC100306572"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

attggcatgaacgataacactgaactagctctcacgtttgtgcttgcacttgcacctctccaacgataacaacgacgagcacaagatccagacaaggcaggcacatagtatggctggaccttttgagttgggttcatcaaagaagaaaccaggggatggagtgaatgatttactcacttttaatgctgaaaatatgcaaagcaacatgaaaattatttattacagccgaacatttttgtctataattggtggagttgttgctggaattttggggttcacaagcttgaaaggatttgtattttacttccttctcatgatggttacttcacttgggcttgtagccaaagccagattttcaatccactcctactttgactcctcgaatcgagttctacttgatggcttcctaggtggtctaatgtcattcgtgctgttctggacatttgcattcgacattgtacatatattttgacggaggatcgtgcacaaaatgtctctaaagaaggcaattgttggcttctgacttctgttgctgctttaagaaggcaattgttctttatcttgattcttgacataatgcatgtacttcatcaagttattggatagctctcattatgttgccagtttttaaactttgtaagctctacttgctaatgctataagaccggtcctgaaattttatggaccaaactgaagcaattatattacttagttctaaattttacggtcacaatgtttccagtttttttttttaccaaaaaaaatagtttgtttcatctgaattctgtcaaaaaaataatgtataatctgaataatggaatgtgaaagtaatgtcatctctc

//