LOCUS       NM_001372138             363 bp    mRNA    linear   PLN 21-AUG-2019
DEFINITION  Solanum lycopersicum CLAVATA3/ESR (CLE)-related protein 9 (CLE9),
            mRNA.
ACCESSION   NM_001372138
VERSION     NM_001372138.1
KEYWORDS    RefSeq.
SOURCE      Solanum lycopersicum (Lycopersicon esculentum)
  ORGANISM  Solanum lycopersicum
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; asterids; lamiids; Solanales; Solanaceae;
            Solanoideae; Solaneae; Solanum; Solanum subgen. Lycopersicon.
REFERENCE   1  (bases 1 to 363)
  AUTHORS   Rodriguez-Leal D, Xu C, Kwon CT, Soyars C, Demesa-Arevalo E, Man J,
            Liu L, Lemmon ZH, Jones DS, Van Eck J, Jackson DP, Bartlett ME,
            Nimchuk ZL and Lippman ZB.
  TITLE     Evolution of buffering in a genetic circuit controlling plant stem
            cell proliferation
  JOURNAL   Nat. Genet. 51 (5), 786-792 (2019)
   PUBMED   30988512
REFERENCE   2  (bases 1 to 363)
  AUTHORS   Xu C, Liberatore KL, MacAlister CA, Huang Z, Chu YH, Jiang K,
            Brooks C, Ogawa-Ohnishi M, Xiong G, Pauly M, Van Eck J,
            Matsubayashi Y, van der Knaap E and Lippman ZB.
  TITLE     A cascade of arabinosyltransferases controls shoot meristem size in
            tomato
  JOURNAL   Nat. Genet. 47 (7), 784-792 (2015)
   PUBMED   26005869
REFERENCE   3  (bases 1 to 363)
  AUTHORS   Zhang Y, Yang S, Song Y and Wang J.
  TITLE     Genome-wide characterization, expression and functional analysis of
            CLV3/ESR gene family in tomato
  JOURNAL   BMC Genomics 15, 827 (2014)
   PUBMED   25266499
  REMARK    Publication Status: Online-Only
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AEKE03003142.1.
            
            ##RefSeq-Attributes-START##
            inferred exon combination :: based on alignments, homology
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-151               AEKE03003142.1     45924059-45924209
            152-210             AEKE03003142.1     45924305-45924363
            211-363             AEKE03003142.1     45924447-45924599
FEATURES             Location/Qualifiers
     source          1..363
                     /organism="Solanum lycopersicum"
                     /mol_type="mRNA"
                     /cultivar="Heinz 1706"
                     /db_xref="taxon:4081"
     gene            1..363
                     /gene="CLE9"
                     /gene_synonym="SlCLE9"
                     /note="CLAVATA3/ESR (CLE)-related protein 9"
                     /db_xref="GeneID:115600545"
     misc_feature    25..27
                     /gene="CLE9"
                     /gene_synonym="SlCLE9"
                     /note="upstream in-frame stop codon"
     CDS             52..324
                     /gene="CLE9"
                     /gene_synonym="SlCLE9"
                     /codon_start=1
                     /product="CLAVATA3/ESR (CLE)-related protein 9 precursor"
                     /protein_id="NP_001359067.1"
                     /db_xref="GeneID:115600545"
                     /translation="

MSLLSTNKYSYPCLMLMAMILCIFLFSMQAQSSDQYSHGKSAMLRDHFIHNRKITKNGKRISQDAGELREAPMSPDPLHHHGGLPRNIMP"

     sig_peptide     52..141
                     /gene="CLE9"
                     /gene_synonym="SlCLE9"
                     /inference="COORDINATES: ab initio prediction:SignalP:4.0"
ORIGIN      

tatttcttctacatataggtaccgtaaattggagttaaaacaaaaatccaaatgtctcttctctctactaacaaatactcctatccctgtttgatgttaatggcgatgatcctctgcatctttctcttctcaatgcaagcacaatcctctgatcaatactcacatggaaaatccgcaatgctgcgtgatcacttcattcacaacagaaagattactaaaaatggaaaaagaataagccaggatgcaggggaactaagagaagcacctatgagtccagaccctttgcatcatcatggaggtctccccaggaatataatgccatagctaattaattagctacctattattatattaatcggcccg

//