2024-05-01 07:01:46, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001270791 950 bp mRNA linear ROD 06-AUG-2023 DEFINITION Mus musculus IBA57 homolog, iron-sulfur cluster assembly (Iba57), transcript variant 2, mRNA; nuclear gene for mitochondrial product. ACCESSION NM_001270791 XM_003688885 VERSION NM_001270791.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 950) AUTHORS Waller JC, Alvarez S, Naponelli V, Lara-Nunez A, Blaby IK, Da Silva V, Ziemak MJ, Vickers TJ, Beverley SM, Edison AS, Rocca JR, Gregory JF 3rd, de Crecy-Lagard V and Hanson AD. TITLE A role for tetrahydrofolates in the metabolism of iron-sulfur clusters in all domains of life JOURNAL Proc Natl Acad Sci U S A 107 (23), 10412-10417 (2010) PUBMED 20489182 REMARK GeneRIF: Mouse COG0354 represents an ancient, folate-dependent protein family involved in the metabolism of Fe/S cluster containing enzymes REFERENCE 2 (bases 1 to 950) AUTHORS Nilsson R, Schultz IJ, Pierce EL, Soltis KA, Naranuntarat A, Ward DM, Baughman JM, Paradkar PN, Kingsley PD, Culotta VC, Kaplan J, Palis J, Paw BH and Mootha VK. TITLE Discovery of genes essential for heme biosynthesis through large-scale gene expression analysis JOURNAL Cell Metab 10 (2), 119-130 (2009) PUBMED 19656490 REMARK GeneRIF: Required for functional heme biosynthesis in erythroid cells. COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AL645854.10, BM935743.1 and AW488265.1. On Aug 2, 2012 this sequence version replaced XM_003688885.1. Transcript Variant: This variant (2) contains alternate 3' exon structure and it thus differs in the 3' coding region and 3' UTR, compared to variant 1. The encoded isoform (2) has a distinct C-terminus and is shorter than isoform 1. ##Evidence-Data-START## Transcript exon combination :: BM935743.1, SRR7345562.1698026.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN01164131, SAMN01164132 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## gene product(s) localized to mito. :: reported by MitoCarta ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-98 AL645854.10 146991-147088 c 99-673 BM935743.1 54-628 674-950 AW488265.1 1-277 c FEATURES Location/Qualifiers source 1..950 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="11" /map="11 36.97 cM" gene 1..950 /gene="Iba57" /gene_synonym="4930543L23Rik; A230051G13Rik; C1orf69" /note="IBA57 homolog, iron-sulfur cluster assembly" /db_xref="GeneID:216792" /db_xref="MGI:MGI:3041174" exon 1..395 /gene="Iba57" /gene_synonym="4930543L23Rik; A230051G13Rik; C1orf69" /inference="alignment:Splign:2.1.0" CDS 55..759 /gene="Iba57" /gene_synonym="4930543L23Rik; A230051G13Rik; C1orf69" /note="isoform 2 precursor is encoded by transcript variant 2; putative transferase C1orf69 homolog, mitochondrial; putative transferase CAF17 homolog, mitochondrial; iron-sulfur cluster assembly factor homolog; IBA57, iron-sulfur cluster assembly homolog" /codon_start=1 /product="putative transferase CAF17 homolog, mitochondrial isoform 2 precursor" /protein_id="NP_001257720.1" /db_xref="GeneID:216792" /db_xref="MGI:MGI:3041174" /translation="
MAAVALLRGAAVGRRSPAWHWRLSGTASHCLARGFGLLGSNPADGVAWTCFRLDGRALVRVRGPDAAPFLLGLSTNELPLSGPPTGAAQPSARAAYAHFLNVQGRTLYDVILYGLLLNCSAVASAVRQLAGLPSLQLWLVNCSAAAATTAVPPPLLTSAVSAASFCYQPSPHYRKQEKKMERSLFSGLLLPHWGKAQESLPTTSLSEPSQPVCIAPERMFGPITDLPIGNLRND"
misc_feature 211..>426 /gene="Iba57" /gene_synonym="4930543L23Rik; A230051G13Rik; C1orf69" /note="Folate-binding Fe-S cluster repair protein YgfZ, possible role in tRNA modification [Posttranslational modification, protein turnover, chaperones]; Region: YgfZ; COG0354" /db_xref="CDD:223431" exon 396..935 /gene="Iba57" /gene_synonym="4930543L23Rik; A230051G13Rik; C1orf69" /inference="alignment:Splign:2.1.0" ORIGIN
gccgccgccgccgcccggggccgctgtggtgcccgccttcacttagcgcccaagatggcagcggtggcgctgcttcggggcgcggctgtggggcgcagaagcccagcttggcactggcggctgagcgggaccgcgagtcactgcctagcccgtggctttggccttcttggcagcaaccccgcggacggtgtggcctggacttgcttccggctggacgggcgcgccttagtgcgcgtgcgcggcccggacgctgcacccttcctgttgggactatcgaccaatgagctgccgctttcggggcctccgaccggcgcggctcagccctctgcgcgtgcggcgtatgcccatttcctgaatgtgcagggacgcacgctctatgacgtcattctgtatgggctgttgttgaactgctcagctgtcgcttcagctgtcagacagctggcaggcttgccttccctgcagctttggcttgtcaactgctcagctgctgccgccaccactgcagttccaccgcctctgctgacctctgctgtctctgctgcttctttctgttaccagcccagcccacactacagaaagcaagaaaagaaaatggagagaagccttttctcgggcctgctgctcccacactggggcaaagctcaggaaagtcttcccacaacctcactaagtgagccttcacagcctgtttgtatcgccccagaaaggatgtttggaccaatcacagacttgcctatcggcaaccttcgtaatgactgaggattgtgttttggacagccataacgctgcatctttagcaatagttacagcagatcctcttctaggctaccagggagctgctgtccatttggccaaattgaaagtggttgcaagatcatctagaattcagtgagacctgtaatggcaaaatgtctgataaaaaccattttaaacaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]