LOCUS       NM_001141512            1065 bp    mRNA    linear   VRT 12-JAN-2022
DEFINITION  Salmo salar ATPase, Cu++ transporting, alpha polypeptide
            (LOC100196483), mRNA.
ACCESSION   NM_001141512
VERSION     NM_001141512.1
KEYWORDS    RefSeq.
SOURCE      Salmo salar (Atlantic salmon)
  ORGANISM  Salmo salar
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Protacanthopterygii;
            Salmoniformes; Salmonidae; Salmoninae; Salmo.
REFERENCE   1  (bases 1 to 1065)
  AUTHORS   Ramberg S, Hoyheim B, Ostbye TK and Andreassen R.
  TITLE     A de novo Full-Length mRNA Transcriptome Generated From
            Hybrid-Corrected PacBio Long-Reads Improves the Transcript
            Annotation and Identifies Thousands of Novel Splice Variants in
            Atlantic Salmon
  JOURNAL   Front Genet 12, 656334 (2021)
   PUBMED   33986770
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1065)
  AUTHORS   Leong JS, Jantzen SG, von Schalburg KR, Cooper GA, Messmer AM, Liao
            NY, Munro S, Moore R, Holt RA, Jones SJ, Davidson WS and Koop BF.
  TITLE     Salmo salar and Esox lucius full-length cDNA sequences reveal
            changes in evolutionary pressures on a post-tetraploidization
            genome
  JOURNAL   BMC Genomics 11, 279 (2010)
   PUBMED   20433749
  REMARK    Publication Status: Online-Only
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BT049930.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BT049930.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN02597923, SAMN02597924
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1065
                     /organism="Salmo salar"
                     /mol_type="mRNA"
                     /db_xref="taxon:8030"
                     /chromosome="ssa05"
                     /map="ssa05"
     gene            1..1065
                     /gene="LOC100196483"
                     /gene_synonym="atp7a"
                     /note="ATPase, Cu++ transporting, alpha polypeptide"
                     /db_xref="GeneID:100196483"
     exon            1..137
                     /gene="LOC100196483"
                     /gene_synonym="atp7a"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    6..8
                     /gene="LOC100196483"
                     /gene_synonym="atp7a"
                     /note="upstream in-frame stop codon"
     CDS             18..680
                     /gene="LOC100196483"
                     /gene_synonym="atp7a"
                     /EC_number="7.2.2.9"
                     /codon_start=1
                     /product="copper-transporting ATPase 1"
                     /protein_id="NP_001134984.1"
                     /db_xref="GeneID:100196483"
                     /translation="

MTLKVKLSSVCLGVEGMTCASCVQSIEQRIGGLPGVVHIKVSLELKNASIIFDHSHHTPESLAEAVEDMGFDSILSDTTTASVVLTETQLVPIPALLTPEAQQEALTRLAQLQAVLEVQENKDQRGVSVTFIPSLISVVQLGEVVSSMAPLLEVPTSNSPTEETLVPAPATVSAPATSSQPQLVKMRIEGMVCLSCTTTIEGKIGKLKGVEKIKGYFVIA"

     misc_feature    57..233
                     /gene="LOC100196483"
                     /gene_synonym="atp7a"
                     /note="Heavy-metal-associated domain (HMA) is a conserved
                     domain of approximately 30 amino acid residues found in a
                     number of proteins that transport or detoxify heavy
                     metals, for example, the CPx-type heavy metal ATPases and
                     copper chaperones. HMA domain...; Region: HMA; cd00371"
                     /db_xref="CDD:238219"
     misc_feature    order(66..74,81..83)
                     /gene="LOC100196483"
                     /gene_synonym="atp7a"
                     /note="metal-binding site [ion binding]"
                     /db_xref="CDD:238219"
     misc_feature    570..>659
                     /gene="LOC100196483"
                     /gene_synonym="atp7a"
                     /note="Heavy-metal-associated domain (HMA) is a conserved
                     domain of approximately 30 amino acid residues found in a
                     number of proteins that transport or detoxify heavy
                     metals, for example, the CPx-type heavy metal ATPases and
                     copper chaperones. HMA domain...; Region: HMA; cd00371"
                     /db_xref="CDD:238219"
     misc_feature    order(588..596,603..605)
                     /gene="LOC100196483"
                     /gene_synonym="atp7a"
                     /note="metal-binding site [ion binding]"
                     /db_xref="CDD:238219"
     exon            138..1065
                     /gene="LOC100196483"
                     /gene_synonym="atp7a"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

cagactaaggacttacaatgacgctgaaggtcaagctgagctcagtttgcctgggtgtagaggggatgacctgtgcttcctgtgttcagtctattgagcagcgcattgggggtcttcctggagtcgtacacatcaaggtgtctctggagctgaagaatgccagcatcatcttcgaccacagtcatcacaccccagagtccctggcggaggccgtggaggacatggggtttgactccatcctctcagacactaccacagcctccgtggtcctcacggagacccagctggtccccatcccagcccttctcacccctgaagcccaacaggaggctctgacgaggctagctcagctccaggcggtcctggaggtccaggagaacaaggaccagaggggggtgtccgttaccttcatcccttccctgatcagtgtagtgcagctgggggaggtggttagtagcatggcccccctcctggaggtccctacatccaatagccctacagaggaaactcttgtcccagctcctgccacagtgtcagccccggccacatcctcacagcctcagctggtgaagatgcggatcgagggcatggtctgtctgtcctgcaccaccaccatcgaagggaagattggcaagctcaaaggagttgagaaaatcaaaggttactttgtaattgcgtagtagtcagccgttttacactgaaggccattatcatttgatcgtgactcaatgagttctgatcaagtgtagtgctgatcttgctaaaggttcaatgcagccatttcaatatcaaatcatttcttggtaacaatgaagtactttactttgattgttttcaattaaaatggtcaaaaagaaacagaaatagcttcttagcaaagagcaatttctcaagcaagaatttagctaggattgtctgggagtggtctaagtggggagaggaaaactagctgttattggcagagatgttgaactctcttattagtcttttaactacactgaacaaaaatataaactcaacatgtaaagttgtttcatgagttgaaataaaagagaagctggggac

//