GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-19 11:49:35, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001046187            1160 bp    mRNA    linear   MAM 25-JUN-2020
DEFINITION  Bos taurus copper chaperone for superoxide dismutase (CCS), mRNA.
ACCESSION   NM_001046187 XM_592961 XM_868869 XM_882024 XM_882037 XM_882047
VERSION     NM_001046187.2
KEYWORDS    RefSeq.
SOURCE      Bos taurus (cattle)
  ORGANISM  Bos taurus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Ruminantia;
            Pecora; Bovidae; Bovinae; Bos.
REFERENCE   1  (bases 1 to 1160)
  AUTHORS   Zimin AV, Delcher AL, Florea L, Kelley DR, Schatz MC, Puiu D,
            Hanrahan F, Pertea G, Van Tassell CP, Sonstegard TS, Marcais G,
            Roberts M, Subramanian P, Yorke JA and Salzberg SL.
  TITLE     A whole-genome assembly of the domestic cow, Bos taurus
  JOURNAL   Genome Biol. 10 (4), R42 (2009)
   PUBMED   19393038
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC112838.1.
            
            On Aug 31, 2012 this sequence version replaced NM_001046187.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC112838.1, EV621955.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN03145412, SAMN03145413
                                           [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-1160              BC112838.1         2-1161
FEATURES             Location/Qualifiers
     source          1..1160
                     /organism="Bos taurus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9913"
                     /chromosome="29"
                     /map="29"
                     /breed="Hereford"
     gene            1..1160
                     /gene="CCS"
                     /note="copper chaperone for superoxide dismutase"
                     /db_xref="BGD:BT25087"
                     /db_xref="GeneID:515022"
                     /db_xref="VGNC:VGNC:26991"
     exon            1..119
                     /gene="CCS"
                     /inference="alignment:Splign:2.1.0"
     CDS             81..731
                     /gene="CCS"
                     /note="superoxide dismutase copper chaperone"
                     /codon_start=1
                     /product="copper chaperone for superoxide dismutase"
                     /protein_id="NP_001039652.1"
                     /db_xref="BGD:BT25087"
                     /db_xref="GeneID:515022"
                     /db_xref="VGNC:VGNC:26991"
                     /translation="
MASDSEDRGTACTLEFAVQMTCQSCVDAVRTSLQGIAGIQSVEVQLENQMVLVQTTLPSQEVQALLEGTGRQAVLKGMGSGLLQNLGAAVAILGGPGPVQGVVRFLQLTPERCLIEGTIDGLQPGLHGLHVHQFGDLTRNCNSCGDHFNPDGMSHGGPQDSERHRGDLGNVRADEDGRAVFRIEDEQLKVRWRRRQGPFLTDPMSEAVVSPQRCGM"
     misc_feature    120..>653
                     /gene="CCS"
                     /note="copper, zinc superoxide dismutase; Region:
                     PLN02957"
                     /db_xref="CDD:215516"
     exon            120..192
                     /gene="CCS"
                     /inference="alignment:Splign:2.1.0"
     exon            193..330
                     /gene="CCS"
                     /inference="alignment:Splign:2.1.0"
     exon            331..508
                     /gene="CCS"
                     /inference="alignment:Splign:2.1.0"
     exon            509..569
                     /gene="CCS"
                     /inference="alignment:Splign:2.1.0"
     exon            570..822
                     /gene="CCS"
                     /inference="alignment:Splign:2.1.0"
     exon            823..1146
                     /gene="CCS"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
ggggctccgcctccccctcccgcggcgcggctccgggctggctcttcagttcctgccttcgggcgatagctggatcctggatggcttcggactcggaggaccgcgggactgcctgcacgctggagttcgcggtgcagatgacctgtcagagctgcgtggacgcggtgcgcacgtccctgcaagggatcgcaggcatccaaagtgtggaggtgcagttggagaaccagatggtcctggtgcagaccaccctgcccagccaggaggtgcaggcccttctagaaggcactgggaggcaggcggtcctcaagggcatgggcagtggcctgttgcagaatttaggggcagccgtggccattctcggggggcctggccctgtgcagggagtggtgcgcttcctgcagctgacccctgagcgctgcctaatcgaggggaccattgatggcctgcagcctgggctgcatgggctccacgtccatcagttcggggacctcacgaggaactgcaacagctgtggggaccactttaaccctgatggaatgtcccatgggggcccccaggactctgaacggcaccgcggagacctggggaatgtccgtgccgatgaggatggccgagctgtcttcaggattgaggacgagcagctgaaggtgaggtggaggagaaggcagggacctttcctaacagatccaatgtctgaggctgttgtctcccctcaaaggtgtgggatgtgattggccgaagcctggtcatcgatgagggagaagatgacctgggccggggcgggcatcccttgtccaggatcacaggaaactcaggagagaggttggcctgtggcatcatcgcacgctctgctggcctcttccagaaccccaagcagatctgctcctgtgatggcctcaccatctgggaggagcggggccggcccatcgctggccagggacggaaggagcctgcccagccccctgcccacctctgagcgcagcctctgcctcgggtctgtcaccgtcctccctgctgagcaccgtccacttccagagggaggccctgctcacccagtcctgggagaaccagtgtgcaggctatgtttgatctcaaagggttgcttgctcttcccttggcaaattaaagttttattttcacatggaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]