2024-05-19 11:49:35, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001046187 1160 bp mRNA linear MAM 25-JUN-2020 DEFINITION Bos taurus copper chaperone for superoxide dismutase (CCS), mRNA. ACCESSION NM_001046187 XM_592961 XM_868869 XM_882024 XM_882037 XM_882047 VERSION NM_001046187.2 KEYWORDS RefSeq. SOURCE Bos taurus (cattle) ORGANISM Bos taurus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Bovidae; Bovinae; Bos. REFERENCE 1 (bases 1 to 1160) AUTHORS Zimin AV, Delcher AL, Florea L, Kelley DR, Schatz MC, Puiu D, Hanrahan F, Pertea G, Van Tassell CP, Sonstegard TS, Marcais G, Roberts M, Subramanian P, Yorke JA and Salzberg SL. TITLE A whole-genome assembly of the domestic cow, Bos taurus JOURNAL Genome Biol. 10 (4), R42 (2009) PUBMED 19393038 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BC112838.1. On Aug 31, 2012 this sequence version replaced NM_001046187.1. ##Evidence-Data-START## Transcript exon combination :: BC112838.1, EV621955.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN03145412, SAMN03145413 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1160 BC112838.1 2-1161 FEATURES Location/Qualifiers source 1..1160 /organism="Bos taurus" /mol_type="mRNA" /db_xref="taxon:9913" /chromosome="29" /map="29" /breed="Hereford" gene 1..1160 /gene="CCS" /note="copper chaperone for superoxide dismutase" /db_xref="BGD:BT25087" /db_xref="GeneID:515022" /db_xref="VGNC:VGNC:26991" exon 1..119 /gene="CCS" /inference="alignment:Splign:2.1.0" CDS 81..731 /gene="CCS" /note="superoxide dismutase copper chaperone" /codon_start=1 /product="copper chaperone for superoxide dismutase" /protein_id="NP_001039652.1" /db_xref="BGD:BT25087" /db_xref="GeneID:515022" /db_xref="VGNC:VGNC:26991" /translation="
MASDSEDRGTACTLEFAVQMTCQSCVDAVRTSLQGIAGIQSVEVQLENQMVLVQTTLPSQEVQALLEGTGRQAVLKGMGSGLLQNLGAAVAILGGPGPVQGVVRFLQLTPERCLIEGTIDGLQPGLHGLHVHQFGDLTRNCNSCGDHFNPDGMSHGGPQDSERHRGDLGNVRADEDGRAVFRIEDEQLKVRWRRRQGPFLTDPMSEAVVSPQRCGM"
misc_feature 120..>653 /gene="CCS" /note="copper, zinc superoxide dismutase; Region: PLN02957" /db_xref="CDD:215516" exon 120..192 /gene="CCS" /inference="alignment:Splign:2.1.0" exon 193..330 /gene="CCS" /inference="alignment:Splign:2.1.0" exon 331..508 /gene="CCS" /inference="alignment:Splign:2.1.0" exon 509..569 /gene="CCS" /inference="alignment:Splign:2.1.0" exon 570..822 /gene="CCS" /inference="alignment:Splign:2.1.0" exon 823..1146 /gene="CCS" /inference="alignment:Splign:2.1.0" ORIGIN
ggggctccgcctccccctcccgcggcgcggctccgggctggctcttcagttcctgccttcgggcgatagctggatcctggatggcttcggactcggaggaccgcgggactgcctgcacgctggagttcgcggtgcagatgacctgtcagagctgcgtggacgcggtgcgcacgtccctgcaagggatcgcaggcatccaaagtgtggaggtgcagttggagaaccagatggtcctggtgcagaccaccctgcccagccaggaggtgcaggcccttctagaaggcactgggaggcaggcggtcctcaagggcatgggcagtggcctgttgcagaatttaggggcagccgtggccattctcggggggcctggccctgtgcagggagtggtgcgcttcctgcagctgacccctgagcgctgcctaatcgaggggaccattgatggcctgcagcctgggctgcatgggctccacgtccatcagttcggggacctcacgaggaactgcaacagctgtggggaccactttaaccctgatggaatgtcccatgggggcccccaggactctgaacggcaccgcggagacctggggaatgtccgtgccgatgaggatggccgagctgtcttcaggattgaggacgagcagctgaaggtgaggtggaggagaaggcagggacctttcctaacagatccaatgtctgaggctgttgtctcccctcaaaggtgtgggatgtgattggccgaagcctggtcatcgatgagggagaagatgacctgggccggggcgggcatcccttgtccaggatcacaggaaactcaggagagaggttggcctgtggcatcatcgcacgctctgctggcctcttccagaaccccaagcagatctgctcctgtgatggcctcaccatctgggaggagcggggccggcccatcgctggccagggacggaaggagcctgcccagccccctgcccacctctgagcgcagcctctgcctcgggtctgtcaccgtcctccctgctgagcaccgtccacttccagagggaggccctgctcacccagtcctgggagaaccagtgtgcaggctatgtttgatctcaaagggttgcttgctcttcccttggcaaattaaagttttattttcacatggaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]