GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-17 14:04:58, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_054953827             565 bp    mRNA    linear   PLN 05-APR-2023
DEFINITION  PREDICTED: Prosopis cineraria uncharacterized LOC129311497
            (LOC129311497), mRNA.
ACCESSION   XM_054953827
VERSION     XM_054953827.1
DBLINK      BioProject: PRJNA948452
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Prosopis cineraria
  ORGANISM  Prosopis cineraria
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; fabids; Fabales; Fabaceae; Caesalpinioideae;
            mimosoid clade; Mimoseae; Prosopis.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_026555336) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_029017545.1-RS_2023_03
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 03/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 1% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..565
                     /organism="Prosopis cineraria"
                     /mol_type="mRNA"
                     /cultivar="Desert tree"
                     /isolate="PC_DT_omini"
                     /db_xref="taxon:364024"
                     /chromosome="Unknown"
                     /tissue_type="leaf"
                     /country="United Arab Emirates: Abu Dhabi"
     gene            1..565
                     /gene="LOC129311497"
                     /note="uncharacterized LOC129311497; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:129311497"
     CDS             80..565
                     /gene="LOC129311497"
                     /codon_start=1
                     /product="uncharacterized protein LOC129311497"
                     /protein_id="XP_054809802.1"
                     /db_xref="GeneID:129311497"
                     /translation="
MKRAKPKSHSKTSNHSHNSSPSLKSFIEPPPDFFPSKHEFLRLIVVLAFASAVAWTCNLFLTSFINPSTKPFCDSNVDFPDSFSDDCEPCPSNGACYDGKLECLQGYRKHGKLCVEDGDINKSAKKISDRVKCSLCEDYAQYLCYGVGSVWVQEDEIWKTF"
     misc_feature    314..>511
                     /gene="LOC129311497"
                     /note="Man1-Src1p-C-terminal domain; Region: MSC;
                     pfam09402"
                     /db_xref="CDD:430586"
ORIGIN      
aacagcagcaaacaagggtgccgtaaaaggcggtctgagcatcccgctcggccggacacatcactctgatctcttccaaatgaagcgcgcaaaacccaagtcccattccaaaacttcaaatcattctcacaattcttctccttctttgaaatcgttcatagaaccccctcctgatttctttccctcgaagcacgagttcctcaggctcatcgtcgtccttgcattcgcatcagcagttgcttggacatgcaatctcttcttgacatcttttattaatccctccaccaagcccttttgcgatagcaacgtagactttccggattcattttccgatgattgtgaaccttgtccaagtaatggagcatgttacgatggcaaattggaatgtctccagggctaccgaaagcatgggaagttgtgtgtagaagatggagatattaataaatcagctaaaaaaatttcggacagagtaaaatgtagcctatgtgaagattatgctcagtatttgtgctatggagtcggatcagtttgggttcaagaggatgaaatatggaaaactttttga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]