2024-05-17 13:09:15, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_048656001 618 bp mRNA linear INV 11-JUN-2022 DEFINITION PREDICTED: Athalia rosae involucrin-like (LOC125501099), mRNA. ACCESSION XM_048656001 VERSION XM_048656001.1 DBLINK BioProject: PRJNA846876 KEYWORDS RefSeq; includes ab initio. SOURCE Athalia rosae (coleseed sawfly) ORGANISM Athalia rosae Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Hymenoptera; Tenthredinoidea; Athaliidae; Athalia. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_064030) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Athalia rosae Annotation Release 103 Annotation Version :: 103 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 9.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..618 /organism="Athalia rosae" /mol_type="mRNA" /db_xref="taxon:37344" /chromosome="5" gene 1..618 /gene="LOC125501099" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:125501099" CDS 1..618 /gene="LOC125501099" /codon_start=1 /product="involucrin-like" /protein_id="XP_048511958.1" /db_xref="GeneID:125501099" /translation="
MEFTRHPSVIQDELNQVDRLKHEFKQLDCLKDKLNQVDRLKHEFKQLDCLKDELNQLDLLKHKFNQLDCLRDKLNQVDRLKNNFNQLDRLKHELNQLDGLKDKLNQVDRLKHEFKQLDCLKDELNQLDLLKHKFNQLDCLRDKLNQVDRLKNNFNQLDRLKHELNQLDGLKDKLNQVDRLKHEFKQLDCLKDELNQLDRLKHNCN"
misc_feature 52..>591 /gene="LOC125501099" /note="Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning]; Region: Smc; COG1196" /db_xref="CDD:224117" ORIGIN
atggagttcactagacacccgagcgtgatacaagatgaattgaatcaagttgatcgcctgaaacacgaattcaagcaacttgattgcctgaaagataaattgaatcaagttgatcgcctgaaacacgaattcaagcaacttgattgcctgaaagatgaattgaatcaacttgatctcctcaaacacaaattcaaccaacttgattgcctgagagataaattgaatcaagttgatcgcctgaaaaacaatttcaaccaacttgatcgcctgaaacacgaactcaaccaacttgatggccttaaagataaattgaatcaagttgatcgcctgaaacacgaattcaagcaacttgattgcctgaaagatgaattgaatcaacttgatctcctcaaacacaaattcaaccaacttgattgcctgagagataaattgaatcaagttgatcgcctgaaaaacaatttcaaccaacttgatcgcctgaaacacgaactcaaccaacttgatggccttaaagataaattgaatcaagttgatcgcctgaaacacgaattcaagcaacttgattgcctgaaagatgaattgaatcaacttgatcgcctgaaacacaattgcaactaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]