2024-05-16 03:38:45, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_016815976 1188 bp mRNA linear PLN 25-APR-2021 DEFINITION PREDICTED: Gossypium hirsutum calcium load-activated calcium channel (LOC107891247), mRNA. ACCESSION XM_016815976 VERSION XM_016815976.2 DBLINK BioProject: PRJNA713846 KEYWORDS RefSeq. SOURCE Gossypium hirsutum (cotton) ORGANISM Gossypium hirsutum Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_053445.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Apr 25, 2021 this sequence version replaced XM_016815976.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Gossypium hirsutum Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1188 /organism="Gossypium hirsutum" /mol_type="mRNA" /isolate="1008001.06" /db_xref="taxon:3635" /chromosome="D09" gene 1..1188 /gene="LOC107891247" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2285 long SRA reads, 7 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:107891247" CDS 378..962 /gene="LOC107891247" /codon_start=1 /product="calcium load-activated calcium channel" /protein_id="XP_016671465.1" /db_xref="GeneID:107891247" /translation="
MATPQFLSSFQYSDSLTVVAISFCTAIVCEAISWLLIYRTNSYKSLKSSIDKAAKKLETMKTDQNPSKLSTKKSKTKKIDRVETSLKESSRDLSLFKFKSGAVVALVLIVVFGFLNSLFEGKVVAKLPFKPIGIVMKMSHRGLKGDDSTDCSMVFLYFLCSISIRTNLQKFLGFSPPRGAAGAGLFPMPDPKTN"
misc_feature 420..899 /gene="LOC107891247" /note="Integral membrane protein DUF106; Region: DUF106; pfam01956" /db_xref="CDD:396507" ORIGIN
gggattataggaggtgtgtttttctgggaacatatctttggagttgaatgctaacaagaagagattgaagttagtctatttaagttgaatgctaacaagaagagattgaagttagtctatttaagtgaatgcttcaagttgaactccgcaaattgtgaaagaaagaggtttcttgagttcatccttttcatttgtaggttgtatcgtttaataatagagataagagatgggttgaaatgagtaagcccatagtggtgagaaataaaaggcaaagcccactccttgggttgtcgtctacttgggattcgaatcaatttgactaggaacggatcacagagactgagagtgaagacacccacccaatcaaccttgtgaaaatggcgacaccccaattcctatcatccttccagtactccgacagtctaacagtcgtagctatctccttttgcactgccattgtctgcgaagccatctcatggctcttaatctaccgcaccaactcttacaaatccctcaaatcctctatcgacaaagccgccaagaaactcgaaaccatgaaaaccgaccaaaaccctagcaagttgtccaccaaaaaatccaaaaccaagaagatcgaccgtgtcgaaaccagcctcaaagaatccagccgtgacctttccttattcaagttcaaatctggggctgtcgtcgccctcgttttgatcgtcgtttttggcttcttgaattctcttttcgaaggcaaagttgtcgccaaattgccctttaagcccatcgggatcgtgatgaagatgagtcatagaggattaaaaggggacgattccaccgattgctccatggtctttctctacttcttgtgttccatcagtataaggactaatttgcagaagtttttggggttttcgccgccgcgaggtgctgctggcgctgggttgttcccaatgcctgatcccaagactaattgagtctttttttcaggttccttttttataatttagctaccgtttgagaatcaagaatttaggtaatggatatttggagttttgggcttttatgtgataattggtgacgacaactggttttatattttaaatcattgttttctaattttgattattgttaacttttataagttccgatgtttgaattttagattggaataatcattgcttgattgtcatctttctctaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]