GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-17 18:57:23, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_130055               1394 bp    mRNA    linear   PLN 20-OCT-2022
DEFINITION  Arabidopsis thaliana homeobox-leucine zipper protein 4 (HB4), mRNA.
ACCESSION   NM_130055
VERSION     NM_130055.2
DBLINK      BioProject: PRJNA116
            BioSample: SAMN03081427
KEYWORDS    RefSeq.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 1394)
  AUTHORS   Lin,X., Kaul,S., Rounsley,S., Shea,T.P., Benito,M.I., Town,C.D.,
            Fujii,C.Y., Mason,T., Bowman,C.L., Barnstead,M., Feldblyum,T.V.,
            Buell,C.R., Ketchum,K.A., Lee,J., Ronning,C.M., Koo,H.L.,
            Moffat,K.S., Cronin,L.A., Shen,M., Pai,G., Van Aken,S., Umayam,L.,
            Tallon,L.J., Gill,J.E., Adams,M.D., Carrera,A.J., Creasy,T.H.,
            Goodman,H.M., Somerville,C.R., Copenhaver,G.P., Preuss,D.,
            Nierman,W.C., White,O., Eisen,J.A., Salzberg,S.L., Fraser,C.M. and
            Venter,J.C.
  TITLE     Sequence and analysis of chromosome 2 of the plant Arabidopsis
            thaliana
  JOURNAL   Nature 402 (6763), 761-768 (1999)
   PUBMED   10617197
REFERENCE   2  (bases 1 to 1394)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1394)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 1394)
  AUTHORS   Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
  CONSRTM   TAIR
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
            Institution, 260 Panama Street, Stanford, CA, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
            This record is derived from an annotated genomic sequence
            (NC_003071).
            
            On Sep 12, 2016 this sequence version replaced NM_130055.1.
FEATURES             Location/Qualifiers
     source          1..1394
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="2"
                     /ecotype="Columbia"
     gene            1..1394
                     /gene="HB4"
                     /locus_tag="AT2G44910"
                     /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE
                     ZIPPER PROTEIN 4; ATHB-4; ATHB4; homeobox-leucine zipper
                     protein 4; T13E15.8"
                     /note="Encodes a homeodomain protein whose expression
                     displays a dependence on phyB for both red and far-red
                     light response. Also involved in the shade avoidance
                     syndrome."
                     /db_xref="Araport:AT2G44910"
                     /db_xref="GeneID:819100"
                     /db_xref="TAIR:AT2G44910"
     CDS             207..1163
                     /gene="HB4"
                     /locus_tag="AT2G44910"
                     /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE
                     ZIPPER PROTEIN 4; ATHB-4; ATHB4; homeobox-leucine zipper
                     protein 4; T13E15.8"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR751659.1,INSD:DR751658.1,INSD:EL294024.1"
                     /inference="similar to RNA sequence, mRNA:INSD:AJ441251.1"
                     /note="homeobox-leucine zipper protein 4 (HB4); FUNCTIONS
                     IN: DNA binding, sequence-specific DNA binding
                     transcription factor activity; INVOLVED IN: response to
                     hormone stimulus, shade avoidance, regulation of
                     transcription, DNA-dependent, response to far red light,
                     regulation of gene-specific transcription; LOCATED IN:
                     nucleus; EXPRESSED IN: 8 plant structures; EXPRESSED
                     DURING: 4 anthesis, F mature embryo stage, petal
                     differentiation and expansion stage, E expanded cotyledon
                     stage, D bilateral stage; CONTAINS InterPro DOMAIN/s:
                     Homeobox, conserved site (InterPro:IPR017970), Homeobox
                     (InterPro:IPR001356), HD-ZIP protein, N-terminal
                     (InterPro:IPR006712), Homeodomain-like
                     (InterPro:IPR009057), Leucine zipper, homeobox-associated
                     (InterPro:IPR003106), Homeodomain-related
                     (InterPro:IPR012287); BEST Arabidopsis thaliana protein
                     match is: homeobox-leucine zipper protein 3
                     (TAIR:AT3G60390.1); Has 8851 Blast hits to 8789 proteins
                     in 513 species: Archae - 0; Bacteria - 2; Metazoa - 6351;
                     Fungi - 241; Plants - 2079; Viruses - 4; Other Eukaryotes
                     - 174 (source: NCBI BLink)."
                     /codon_start=1
                     /product="homeobox-leucine zipper protein 4"
                     /protein_id="NP_182018.1"
                     /db_xref="Araport:AT2G44910"
                     /db_xref="GeneID:819100"
                     /db_xref="TAIR:AT2G44910"
                     /translation="
MGERDDGLGLSLSLGNSQQKEPSLRLNLMPLTTSSSSSSFQHMHNQNNNSHPQKIHNISWTHLFQSSGIKRTTAERNSDAGSFLRGFNVNRAQSSVAVVDLEEEAAVVSSPNSAVSSLSGNKRDLAVARGGDENEAERASCSRGGGSGGSDDEDGGNGDGSRKKLRLSKDQALVLEETFKEHSTLNPKQKLALAKQLNLRARQVEVWFQNRRARTKLKQTEVDCEYLKRCCDNLTEENRRLQKEVSELRALKLSPHLYMHMTPPTTLTMCPSCERVSSSAATVTAAPSTTTTPTVVGRPSPQRLTPWTAISLQQKSGR"
     misc_feature    225..578
                     /gene="HB4"
                     /locus_tag="AT2G44910"
                     /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE
                     ZIPPER PROTEIN 4; ATHB-4; ATHB4; homeobox-leucine zipper
                     protein 4; T13E15.8"
                     /note="HD-ZIP protein N-terminus; Region: HD-ZIP_N;
                     pfam04618"
                     /db_xref="CDD:428039"
     misc_feature    order(690..701,705..707,756..758,774..776,813..815,
                     819..824,831..836,840..848,852..857)
                     /gene="HB4"
                     /locus_tag="AT2G44910"
                     /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE
                     ZIPPER PROTEIN 4; ATHB-4; ATHB4; homeobox-leucine zipper
                     protein 4; T13E15.8"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(693..695,702..704,822..824,831..836,843..845)
                     /gene="HB4"
                     /locus_tag="AT2G44910"
                     /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE
                     ZIPPER PROTEIN 4; ATHB-4; ATHB4; homeobox-leucine zipper
                     protein 4; T13E15.8"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    702..854
                     /gene="HB4"
                     /locus_tag="AT2G44910"
                     /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE
                     ZIPPER PROTEIN 4; ATHB-4; ATHB4; homeobox-leucine zipper
                     protein 4; T13E15.8"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     misc_feature    858..989
                     /gene="HB4"
                     /locus_tag="AT2G44910"
                     /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE
                     ZIPPER PROTEIN 4; ATHB-4; ATHB4; homeobox-leucine zipper
                     protein 4; T13E15.8"
                     /note="homeobox associated leucin zipper; Region: HALZ;
                     smart00340"
                     /db_xref="CDD:128634"
ORIGIN      
cattgaaattacaagggtctttctgacacaagtcatcattgaaaccccaagcaccccacataaccccttctctctattaattgtctacatatcaacttctgtgtatatatatattagtcgtgtctttaaccccattatcactacatcgattttctcgagaaagtctttcaaaatccagaaaagaaaagttctttctgttgaggacaatgggggaaagagatgatgggttgggtttgagtctaagcttgggaaatagtcaacaaaaagaaccatctctgaggttgaatcttatgccgttgacaacttcttcttcttcttcttcgtttcaacacatgcacaatcagaataacaatagccatccccagaagattcataacatctcttggactcatctgtttcaatcttctgggattaaacgtacaactgcagagagaaactccgacgccgggtcatttctaagaggtttcaacgtgaacagagctcagtcttcggtggcggtagtggacttggaagaagaagccgccgtcgtctcgtctccaaacagcgccgtttcgagtctgagtggaaataaaagggatcttgcggtggcgagaggaggagatgaaaacgaggcggagagagcttcttgctcacgcggagggggaagcggtggtagcgacgatgaagacggcggaaacggcgacggatcaaggaagaaactacggttatcgaaggatcaagctcttgttctcgaggagacttttaaagaacatagcactcttaatccgaagcaaaagctggctctagcaaaacagttgaatctaagggcaagacaagttgaagtgtggtttcagaaccgtagggcaaggacgaagctgaaacaaacggaggttgattgtgagtatttaaagagatgttgcgataatctgaccgaggagaatcgacggctgcagaaagaagtgtcggagctgagggcgttgaagttgtctccacatctctacatgcacatgactcctcctactactctcaccatgtgcccttcttgcgaacgtgtctcctcctctgccgccactgtgaccgctgctccttccactactactactcctacggtggtggggcggccaagtccacagcgattaactccttggactgctatttctctccagcaaaaatcaggtcgctagggaaggagtatcttcggtagttttagcttagaataaagatatgagtatgaaagtttcaaagattagcttctatctattgaaaatgaaaacaaagattagtctcaattcaaagggttcaatttgaggctctaattctgaatttgttttaacctgtaaaaggattaccctttttagaattcagttttgtgagtatatttgattgtttattacctctaaaatcatgagagagat
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]